Regucalcin Antibody


Independent Antibodies: Western Blot: Regucalcin Antibody [NBP1-80850] - Analysis using Anti-RGN antibody NBP1-80850 (A) shows similar pattern to independent antibody NBP1-80849 (B).
Immunocytochemistry/ Immunofluorescence: Regucalcin Antibody [NBP1-80850] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human kidney.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human adrenal gland, kidney, liver and testis using Anti-RGN antibody NBP1-80850 (A) shows similar protein more
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human testis using Anti-RGN antibody.
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining of human liver using Anti-RGN antibody.
Independent Antibodies: Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80850] - Staining in human adrenal gland and cerebral cortex tissues using anti-RGN antibody. Corresponding RGN RNA-seq data are more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Regucalcin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC
Specificity of human Regucalcin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Regucalcin Protein (NBP1-80850PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Regucalcin Antibody

  • EC
  • gluconolactonase
  • GNL
  • RCsenescence marker protein-30
  • regucalcin (senescence marker protein-30)
  • Senescence marker protein 30
  • SMP-30
  • SMP30regucalcin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Regucalcin Antibody (NBP1-80850) (0)

There are no publications for Regucalcin Antibody (NBP1-80850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Regucalcin Antibody (NBP1-80850) (0)

There are no reviews for Regucalcin Antibody (NBP1-80850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Regucalcin Antibody (NBP1-80850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Regucalcin Products

Bioinformatics Tool for Regucalcin Antibody (NBP1-80850)

Discover related pathways, diseases and genes to Regucalcin Antibody (NBP1-80850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Regucalcin Antibody (NBP1-80850)

Discover more about diseases related to Regucalcin Antibody (NBP1-80850).

Pathways for Regucalcin Antibody (NBP1-80850)

View related products by pathway.

PTMs for Regucalcin Antibody (NBP1-80850)

Learn more about PTMs related to Regucalcin Antibody (NBP1-80850).

Blogs on Regucalcin

There are no specific blogs for Regucalcin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Regucalcin Antibody and receive a gift card or discount.


Gene Symbol RGN