Recombinant Human REEP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human REEP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-185 of Human REEP5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Protein/Peptide Type
Recombinant Protein
Gene
REEP5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REEP5 Protein

  • C5orf18polyposis coli region hypothetical protein DP1
  • chromosome 5 open reading frame 18
  • D5S346deleted in polyposis 1
  • DP1TB2YOP1
  • MGC70440
  • Polyposis locus protein 1
  • Protein TB2
  • receptor accessory protein 5
  • receptor expression enhancing protein 5
  • receptor expression-enhancing protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16216
Species: Hu, Mu
Applications: WB
NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
MAB6487
Species: Hu
Applications: WB, ICC
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF4885
Species: Mu
Applications: WB, IP
H00007905-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no publications for REEP5 Recombinant Protein (H00007905-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no reviews for REEP5 Recombinant Protein (H00007905-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REEP5 Products

Bioinformatics Tool for REEP5 Recombinant Protein (H00007905-P01)

Discover related pathways, diseases and genes to REEP5 Recombinant Protein (H00007905-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REEP5 Recombinant Protein (H00007905-P01)

Discover more about diseases related to REEP5 Recombinant Protein (H00007905-P01).
 

Pathways for REEP5 Recombinant Protein (H00007905-P01)

View related products by pathway.

Blogs on REEP5

There are no specific blogs for REEP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human REEP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REEP5