Recombinant Human REEP5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human REEP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-185 of Human REEP5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
REEP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
47.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REEP5 Protein

  • C5orf18polyposis coli region hypothetical protein DP1
  • chromosome 5 open reading frame 18
  • D5S346deleted in polyposis 1
  • DP1TB2YOP1
  • MGC70440
  • Polyposis locus protein 1
  • Protein TB2
  • receptor accessory protein 5
  • receptor expression enhancing protein 5
  • receptor expression-enhancing protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16216
Species: Hu, Mu
Applications: WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB110-59909
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western
27020002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB6487
Species: Hu
Applications: WB, ICC
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007905-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no publications for REEP5 Recombinant Protein (H00007905-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no reviews for REEP5 Recombinant Protein (H00007905-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REEP5 Recombinant Protein (H00007905-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REEP5 Products

Bioinformatics Tool for REEP5 Recombinant Protein (H00007905-P01)

Discover related pathways, diseases and genes to REEP5 Recombinant Protein (H00007905-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REEP5 Recombinant Protein (H00007905-P01)

Discover more about diseases related to REEP5 Recombinant Protein (H00007905-P01).
 

Pathways for REEP5 Recombinant Protein (H00007905-P01)

View related products by pathway.

Blogs on REEP5

There are no specific blogs for REEP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human REEP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REEP5