RCN1 Antibody (4D9-G3)

Images

 
Sandwich ELISA: RCN1 Antibody (4D9-G3) [H00005954-M02] - Detection limit for recombinant GST tagged RCN1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4D9-G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RCN1 Antibody (4D9-G3) Summary

Immunogen
RCN1 (AAH10120, 31 a.a. - 331 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RCN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCN1 Antibody (4D9-G3)

  • FLJ37041
  • FLJ55835
  • PIG20
  • proliferation-inducing gene 20
  • RCAL
  • RCN
  • reticulocalbin 1, EF-hand calcium binding domain
  • reticulocalbin-1

Background

Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84972
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47284
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RCN1 Antibody (H00005954-M02) (0)

There are no publications for RCN1 Antibody (H00005954-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCN1 Antibody (H00005954-M02) (0)

There are no reviews for RCN1 Antibody (H00005954-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCN1 Antibody (H00005954-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCN1 Products

Bioinformatics Tool for RCN1 Antibody (H00005954-M02)

Discover related pathways, diseases and genes to RCN1 Antibody (H00005954-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCN1 Antibody (H00005954-M02)

Discover more about diseases related to RCN1 Antibody (H00005954-M02).
 

Pathways for RCN1 Antibody (H00005954-M02)

View related products by pathway.

PTMs for RCN1 Antibody (H00005954-M02)

Learn more about PTMs related to RCN1 Antibody (H00005954-M02).
 

Research Areas for RCN1 Antibody (H00005954-M02)

Find related products by research area.

Blogs on RCN1

There are no specific blogs for RCN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCN1 Antibody (4D9-G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RCN1
Uniprot