Recombinant Human RCC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RCC1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-421 of Human RCC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
71.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RCC1 Protein

  • Cell cycle regulatory protein
  • CHC1RCC1-I
  • chromosome condensation 1
  • Chromosome condensation protein 1
  • guanine nucleotide-releasing protein
  • regulator of chromosome condensation 1
  • regulator of chromosome condensation
  • SNHG3-RCC1 readthrough transcript
  • SNHG3-RCC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NB100-79814
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82520
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for RCC1 Recombinant Protein (H00001104-P01) (0)

There are no publications for RCC1 Recombinant Protein (H00001104-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCC1 Recombinant Protein (H00001104-P01) (0)

There are no reviews for RCC1 Recombinant Protein (H00001104-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCC1 Recombinant Protein (H00001104-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RCC1 Products

Bioinformatics Tool for RCC1 Recombinant Protein (H00001104-P01)

Discover related pathways, diseases and genes to RCC1 Recombinant Protein (H00001104-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCC1 Recombinant Protein (H00001104-P01)

Discover more about diseases related to RCC1 Recombinant Protein (H00001104-P01).
 

Pathways for RCC1 Recombinant Protein (H00001104-P01)

View related products by pathway.

PTMs for RCC1 Recombinant Protein (H00001104-P01)

Learn more about PTMs related to RCC1 Recombinant Protein (H00001104-P01).
 

Research Areas for RCC1 Recombinant Protein (H00001104-P01)

Find related products by research area.

Blogs on RCC1.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm.  Transportin 1 is co...  Read full blog post.

Customers Who Bought This Also Bought

RCC1 Antibody
NBP1-85637
LONP1 Antibody
NBP1-81734

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RCC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RCC1