RCBTB1 Antibody (1E4)

Sandwich ELISA: RCBTB1 Antibody (1E4) [H00055213-M07] - Detection limit for recombinant GST tagged RCBTB1 is 0.03 ng/ml as a capture antibody.

Product Discontinued

RCBTB1 Antibody (1E4) Summary

• Immunogen: RCBTB1 (NP_060661.3, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RCBTB1
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA 1:100 - 1:2000
  • Sandwich ELISA
  • Western Blot 1:100 - 1:2000

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCBTB1 Antibody (1E4)

• Chronic lymphocytic leukemia deletion region gene 7 protein
• CLL deletion region gene 7 protein
• CLLD7MGC33184
• CLLL7
• E4.5
• FLJ10716
• GDP/GTP exchange factor (GEF)-like protein
• GLP
• RCC1 and BTB domain-containing protein 1
• regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 1
• Regulator of chromosome condensation and BTB domain-containing protein 1
• RP11-185C18.1

Background

Residing in the cytoplasm and nucleus, RCBTB1 is involved in cell cycle regulation by chromatin remodeling. More specifically, RCBTB1 encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB domain. This gene interacts with MAP1LC3B, ATG16L1, CLN3, FYCO1 and GABARAP. Mapping to chromosome 13q in humans, this gene is commonly deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. Common diseases associated with RCBTB1 include alcoholism, asthma, hypertrophy and chronic lymphocytic leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCBTB1