RBMY1A1 Recombinant Protein Antigen

Images

 
There are currently no images for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBMY1A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBMY1A1.

Source: E. coli

Amino Acid Sequence: MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBMY1A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54662.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBMY1A1 Recombinant Protein Antigen

  • MGC181956
  • RBM
  • RBM1
  • RBM2
  • RBMY
  • RBMY1C
  • RNA binding motif protein, Y chromosome, family 1, member A1
  • RNA binding motif protein, Y-linked, family 1, member A1
  • RNA binding protein
  • RNA-binding motif protein 1
  • RNA-binding motif protein 2
  • RNA-binding motif protein, Y chromosome, family 1 member A1/C
  • y chromosome RNA recognition motif 1
  • YRRM1
  • YRRM2

Background

RBMY1A1 encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the encoded protein is thought to be involved in spermatogenesis. Most copies of this locus are pseudogenes, although six highly similar copies have full-length ORFs and are considered functional. Four functional copies of this gene are found within inverted repeat IR2; two functional copies of this gene are found in palindrome P3, along with two copies of PTPN13-like, Y-linked. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP3-17556
Species: Hu
Applications: ICC/IF
NBP3-27724
Species: Hu
Applications: ICC/IF, IHC, WB
NBP3-48031
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
H00027288-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP3-16073
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-2437
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PCR, PEP-ELISA, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP3-23927
Species: Hu
Applications:  IHC-P
NBP1-98290
Species: Hu
Applications: WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
H00159119-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-15143
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-54662PEP
Species: Hu
Applications: AC

Publications for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP) (0)

There are no publications for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP) (0)

There are no reviews for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBMY1A1 Recombinant Protein Antigen (NBP2-54662PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBMY1A1 Products

Blogs on RBMY1A1

There are no specific blogs for RBMY1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBMY1A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBMY1A1