RBMS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBMS2 Antibody [NBP2-55471] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBMS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ
Specificity
Specificity of human RBMS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBMS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBMS2 Recombinant Protein Antigen (NBP2-55471PEP)

Reactivity Notes

Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RBMS2 Antibody

  • FLJ39093
  • FLJ40023
  • RNA binding motif, single stranded interacting protein 2
  • RNA-binding motif, single-stranded-interacting protein 2
  • SCR3FLJ43262
  • Suppressor of CDC2 with RNA-binding motif 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-45533
Species: Hu
Applications: WB, IHC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-90214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready
H00026292-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for RBMS2 Antibody (NBP2-55471) (0)

There are no publications for RBMS2 Antibody (NBP2-55471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMS2 Antibody (NBP2-55471) (0)

There are no reviews for RBMS2 Antibody (NBP2-55471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBMS2 Antibody (NBP2-55471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RBMS2 Products

Bioinformatics Tool for RBMS2 Antibody (NBP2-55471)

Discover related pathways, diseases and genes to RBMS2 Antibody (NBP2-55471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RBMS2 Antibody (NBP2-55471)

View related products by pathway.

Blogs on RBMS2

There are no specific blogs for RBMS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBMS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBMS2