RBMS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RBMS2 Antibody [NBP1-92321] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and RBMS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBMS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBMS2 Antibody - BSA Free (NBP1-92321) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBMS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RBMS2 Protein (NBP1-92321PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBMS2 Antibody - BSA Free

• FLJ39093
• FLJ40023
• RNA binding motif, single stranded interacting protein 2
• RNA-binding motif, single-stranded-interacting protein 2
• SCR3FLJ43262
• Suppressor of CDC2 with RNA-binding motif 3

Background

RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2) belongs to a group of RBMS proteins which bind single stranded DNA/RNA. RBMS2 is known to have interactions with FAM69B and MYC. RBMS2 has been studied in relation to measles, malaria and pyelonephritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBMS2