RBMS1 Recombinant Protein Antigen

Images

 
There are currently no images for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBMS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBMS1.

Source: E. coli

Amino Acid Sequence: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBMS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57279.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBMS1 Recombinant Protein Antigen

  • chromosome 2 open reading frame 12
  • DKFZp564H0764
  • HCC-4
  • MGC15146
  • MGC3331
  • MGC97258
  • MGC97270
  • MGC97282
  • MGC99543
  • MSSP1
  • MSSP-1
  • MSSP-2
  • MSSP-3
  • RNA binding motif, single stranded interacting protein 1
  • SCR2MGC70597
  • single-stranded-interacting protein 1
  • suppressor of cdc 2 (cdc13) with RNA binding motif 2

Background

RBMS1 encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Multiple transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. Several of these were isolated by virtue of their binding to either strand of an upstream element of c-myc (MSSPs), or by phenotypic complementation of cdc2 and cdc13 mutants of yeast (scr2), or as a potential human repressor of HIV-1 and ILR-2 alpha promoter transcription (YC1). A pseudogene for this locus is found on chromosome 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-92321
Species: Hu
Applications: IHC,  IHC-P, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
AF2009
Species: Hu
Applications: ICC, IHC
802-HC/CF
Species: Hu
Applications: BA, BA
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
7268-CT
Species: Hu
Applications: BA
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
DRN00B
Species: Hu
Applications: ELISA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP) (0)

There are no publications for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP) (0)

There are no reviews for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBMS1 Recombinant Protein Antigen (NBP2-57279PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBMS1 Products

Blogs on RBMS1

There are no specific blogs for RBMS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBMS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBMS1