RBM5 Antibody (2B6)

Images

 
Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi ( Cat # H00010181-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Immunocytochemistry/ Immunofluorescence: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M01), clone 2B6.Lane 1: RBM5 transfected lysate(61.5 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
Clone
2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBM5 Antibody (2B6) Summary

Immunogen
RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED
Specificity
RBM5 - RNA binding motif protein 5
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM5 Antibody (2B6)

  • G15
  • H37
  • LUCA15FLJ39876
  • Protein G15
  • Putative tumor suppressor LUCA15
  • Renal carcinoma antigen NY-REN-9
  • RMB5
  • RNA binding motif protein 5
  • RNA-binding motif protein 5
  • RNA-binding protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5534
Species: Hu
Applications: WB, Flow, IHC
NBP1-89376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00221527-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-91687
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-94913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-84951
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-94272
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6438
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P

Publications for RBM5 Antibody (H00010181-M01) (0)

There are no publications for RBM5 Antibody (H00010181-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM5 Antibody (H00010181-M01) (0)

There are no reviews for RBM5 Antibody (H00010181-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM5 Antibody (H00010181-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RBM5 Products

Bioinformatics Tool for RBM5 Antibody (H00010181-M01)

Discover related pathways, diseases and genes to RBM5 Antibody (H00010181-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM5 Antibody (H00010181-M01)

Discover more about diseases related to RBM5 Antibody (H00010181-M01).
 

Pathways for RBM5 Antibody (H00010181-M01)

View related products by pathway.

PTMs for RBM5 Antibody (H00010181-M01)

Learn more about PTMs related to RBM5 Antibody (H00010181-M01).

Blogs on RBM5

There are no specific blogs for RBM5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM5 Antibody (2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM5
Entrez
OMIM