Home » RBM5 » RBM5 Antibodies » RBM5 Antibody (2B6)

RBM5 Antibody (2B6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi ( Cat # H00010181-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM5 monoclonal antibody (M01), clone 2B6 (Cat # H00010181-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi ( Cat # H00010181-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Immunocytochemistry/ Immunofluorescence: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M01), clone 2B6.Lane 1: RBM5 transfected lysate(61.5 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
Clone
2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RBM5 Antibody (2B6) Summary

Immunogen
RBM5 (AAH02957, 75 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED
Specificity
RBM5 - RNA binding motif protein 5
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM5 Antibody (2B6)

  • G15
  • H37
  • LUCA15FLJ39876
  • Protein G15
  • Putative tumor suppressor LUCA15
  • Renal carcinoma antigen NY-REN-9
  • RMB5
  • RNA binding motif protein 5
  • RNA-binding motif protein 5
  • RNA-binding protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GPER/GPR30
Antibody [Unconjugate
AF5534
Western blot shows lysates of human brain cortex tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human GPER Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5534) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for GPER at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
GPER was detected in immersion fixed paraffin-embedded sections of human brain (hypothalamus) using Goat Anti-Human GPER Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5534) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
HEK293 human embryonic kidney cell line transfected with (A) human GPER/GRP30 or (B) irrelevant transfectants, and eGFP was stained with Goat Anti-Human GPER/GPR30 Affinity-Purified Polyclonal Antibody (Catalog # AF5534) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). Quadrants were set based on Goat IgG Flow Cytometry Isotype Control (Catalog # AB-108-C, data not shown). View our protocol for Staining Membrane-associated Proteins.
(2 Publications)
Species: Hu
Applications: WB, Flow, IHC
RBM6 Antibody
NBP1-89376
Western Blot: RBM6 Antibody [NBP1-89376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89376] - Staining of human kidney.
Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89376] - Staining of human colon shows distinct nuclear positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
BUD31 Antibody
NBP1-84010
Western Blot: BUD31 Antibody [NBP1-84010] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: BUD31 Antibody [NBP1-84010] - Staining of human cell line U-2 OS shows localization to nucleus & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BUD31 Antibody [NBP1-84010] - Staining of human nasopharynx shows strong cytoplasmic and nuclear positivity in respiratory epithelial cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ZBTB12 Antibody
H00221527-B01P
Western Blot: ZBTB12 Antibody [H00221527-B01P] - Analysis of ZBTB12 expression in transfected 293T cell line by ZBTB12 polyclonal antibody. Lane 1: ZBTB12 transfected lysate(50.49 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ZBTB12 Antibody [H00221527-B01P] - Analysis of purified antibody to ZBTB12 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
CISH/CIS-1 Antibody
NBP1-30943
Western Blot: CISH/CIS-1 Antibody [NBP1-30943] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: CISH/CIS-1 Antibody [NBP1-30943] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: CISH/CIS-1 Antibody [NBP1-30943] - Paraffin-embedded Lung CA, using antibody at 1:100 dilution.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Recombinant Human
GPSM3 GST (N-Term) Pr ...
H00063940-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
ATF6 beta Antibody
NBP1-91687
Western Blot: ATF6 beta Antibody [NBP1-91687] - Analysis in human cell line SK-MEL-30 and human cell line PC-3.
Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
TSG Antibody
AF756
TSG was detected in immersion fixed frozen sections of mouse embryo using 15 µg/mL Goat Anti-Mouse TSG Antigen Affinity-purified Polyclonal Antibody (Catalog # AF756) overnight at 4 °C. Tissue was stained (red) and counter­stained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
TSG was detected in immersion fixed frozen sections of mouse embryo using Goat Anti-Mouse TSG Antigen Affinity-purified Polyclonal Antibody (Catalog # AF756) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: WB, IHC
RNF5 Antibody
NBP2-94913
Western Blot: RNF5 Antibody [NBP2-94913] - Analysis of extracts of various cell lines, using RNF5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Paraffin-embedded rat liver using RNF5.
Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Paraffin-embedded human liver cancer using RNF5.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
G protein alpha-13
Antibody
NBP3-03844
Western Blot: G protein alpha-13 Antibody [NBP3-03844] - Analysis of extracts from normal (control) and GNA13 knockout (KO) HeLa cells, using G protein alpha-13 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP3-03844] - Analysis of NIH-3T3 cells using G protein alpha-13 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: G protein alpha-13 Antibody [NBP3-03844] - Paraffin-embedded human stomach using G protein alpha-13 antibody (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
RBM10 Antibody
NBP1-84951
Western Blot: RBM10 Antibody [NBP1-84951] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RBM10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: RBM10 Antibody [NBP1-84951] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
PPT2 Antibody
NBP2-94272
Western Blot: PPT2 Antibody [NBP2-94272] - Analysis of extracts of mouse liver, using PPT2 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunohistochemistry-Paraffin: PPT2 Antibody [NBP2-94272] - Paraffin-embedded mouse heart using PPT2.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
BAT3/BAG6 Antibody
AF6438
Western blot shows lysates of A431 human epithelial carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, BaF3 mouse pro-B cell line, CH‑1 mouse B cell lymphoma cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6438) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BAT3/BAG6 at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
BAT3/BAG6 was detected in immersion fixed immature human dendritic cells using Sheep Anti-Human/Mouse/Rat BAT3/BAG6 Affinity-purified Polyclonal Antibody (Catalog # AF6438) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counter­stained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, ICC
GLS2 Antibody
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P

Publications for RBM5 Antibody (H00010181-M01) (0)

There are no publications for RBM5 Antibody (H00010181-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM5 Antibody (H00010181-M01) (0)

There are no reviews for RBM5 Antibody (H00010181-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM5 Antibody (H00010181-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RBM5 Products

Bioinformatics Tool for RBM5 Antibody (H00010181-M01)

Discover related pathways, diseases and genes to RBM5 Antibody (H00010181-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM5 Antibody (H00010181-M01)

Discover more about diseases related to RBM5 Antibody (H00010181-M01).
 

Pathways for RBM5 Antibody (H00010181-M01)

View related products by pathway.

PTMs for RBM5 Antibody (H00010181-M01)

Learn more about PTMs related to RBM5 Antibody (H00010181-M01).

Blogs on RBM5

There are no specific blogs for RBM5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM5 Antibody (2B6) and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM5
Entrez
OMIM