RBEL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBEL1 Antibody [NBP1-91741] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome.
Immunohistochemistry: RBEL1 Antibody [NBP1-91741] - Immunohistochemical staining of human prostate shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBEL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVV
Specificity
Specificity of human RBEL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RABL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBEL1 Protein (NBP1-91741PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBEL1 Antibody

  • bA216L13.9
  • chromosome 9 open reading frame 86
  • FLJ10101
  • FLJ13045
  • KIAA1984
  • Parf
  • Partner of ARF
  • pp8875
  • putative GTP-binding protein Parf
  • Rab-like GTP-binding protein 1
  • Rab-like GTP-binding protein 1C
  • Rab-like protein 1
  • RBEL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46320
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4195
Species: Hu
Applications: WB
H00079800-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF4937
Species: Hu
Applications: WB, IHC
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-57614
Species: Hu
Applications: ICC/IF
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for RBEL1 Antibody (NBP1-91741) (0)

There are no publications for RBEL1 Antibody (NBP1-91741).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBEL1 Antibody (NBP1-91741) (0)

There are no reviews for RBEL1 Antibody (NBP1-91741). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBEL1 Antibody (NBP1-91741) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RBEL1 Antibody (NBP1-91741)

Discover related pathways, diseases and genes to RBEL1 Antibody (NBP1-91741). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RBEL1

There are no specific blogs for RBEL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBEL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RABL6