RbAp46 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RbAp46 Antibody - BSA Free (NBP2-86767) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RbAp46. Peptide sequence: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RBBP7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for RbAp46 Antibody - BSA Free
Background
RBBP7 antibody, also known as RbAp46 (Retinoblastoma protein associated protein 46), is a nuclear protein that has been shown to interact directly with retinoblastoma protein and is a component of the mSin3 corepressor complex, as are the histone deacetylase proteins (HDACs). It shares about 75% sequence identity with the closely related RbAp48, and appears to be functionally related to the yeast MSI1 protein in that overexpression of RbAp46 suppresses heat shock sensitivity in a RAS pathway dependent manner. RBBP7 has also been demonstrated to be up-regulated by the Wilms' tumor suppressor gene product, WT1. In addition, cells transfected with this antibody have shown strong inhibition of growth.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB
Publications for RbAp46 Antibody (NBP2-86767) (0)
There are no publications for RbAp46 Antibody (NBP2-86767).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RbAp46 Antibody (NBP2-86767) (0)
There are no reviews for RbAp46 Antibody (NBP2-86767).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RbAp46 Antibody (NBP2-86767) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RbAp46 Products
Research Areas for RbAp46 Antibody (NBP2-86767)
Find related products by research area.
|
Blogs on RbAp46