We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RB associated KRAB repressor Recombinant Protein Antigen

Images

 
There are currently no images for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RB associated KRAB repressor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RB associated KRAB repressor.

Source: E. coli

Amino Acid Sequence: EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBAK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55962.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RB associated KRAB repressor Recombinant Protein Antigen

  • hRBaK
  • RB-associated KRAB repressor
  • RB-associated KRAB zinc finger protein
  • RB-associated KRAB zinc finger
  • ZNF769Zinc finger protein 769

Background

RB associated KRAB repressor, also known as ZNF769, consists of a 83 kDa 714 and a shorter 12 kDa 113 isoform. Its function is to promote AR-dependent transcription by encoding a nuclear protein. Current research on RB associated KRAB repressor is being conducted in its relationship to retinoblastoma, hyperaldosteronism and familial hyperaldosteronism. RB associated KRAB repressor is known to interact with SUMO1, RB1, AR and SMARCAD1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6947
Species: Hu
Applications: WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-26691
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
NBP3-04538
Species: Hu
Applications: ICC/IF, KO, WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
NBP2-49223
Species: Hu
Applications: IHC,  IHC-P
NBP1-86907
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB

Publications for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP) (0)

There are no publications for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP) (0)

There are no reviews for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RB associated KRAB repressor Recombinant Protein Antigen (NBP2-55962PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RB associated KRAB repressor Products

Blogs on RB associated KRAB repressor

There are no specific blogs for RB associated KRAB repressor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RB associated KRAB repressor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBAK