RASSF10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RASSF10 Antibody [NBP2-68639] - Staining of human cell line A549 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
RASSF10 Recombinant Protein Antigen (NBP2-68639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RASSF10 Antibody

  • Peptidylglycine Alpha-Amidating Monooxygenase COOH-Terminal Interactor-Like
  • Ras Association (RalGDS/AF-6) Domain Family (N-Terminal) Member 10
  • Ras Association Domain-Containing Protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-55145
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5639
Species: Hu, Mu
Applications: ICC, WB
NBP1-89425
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88128
Species: Hu
Applications: IHC, IHC-P, WB
NB500-248
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89249
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20163
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80938
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-82101
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-47804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP3-05039
Species: Hu, Mu, Rt
Applications: IHC, WB
H00011228-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Publications for RASSF10 Antibody (NBP2-68639) (0)

There are no publications for RASSF10 Antibody (NBP2-68639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF10 Antibody (NBP2-68639) (0)

There are no reviews for RASSF10 Antibody (NBP2-68639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASSF10 Antibody (NBP2-68639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF10 Products

Bioinformatics Tool for RASSF10 Antibody (NBP2-68639)

Discover related pathways, diseases and genes to RASSF10 Antibody (NBP2-68639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF10 Antibody (NBP2-68639)

Discover more about diseases related to RASSF10 Antibody (NBP2-68639).
 

Pathways for RASSF10 Antibody (NBP2-68639)

View related products by pathway.

PTMs for RASSF10 Antibody (NBP2-68639)

Learn more about PTMs related to RASSF10 Antibody (NBP2-68639).
 

Research Areas for RASSF10 Antibody (NBP2-68639)

Find related products by research area.

Blogs on RASSF10

There are no specific blogs for RASSF10, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF10