Home » RASSF10 » RASSF10 Antibodies » RASSF10 Antibody

RASSF10 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RASSF10 Antibody [NBP2-68639] - Staining of human cell line A549 shows localization to vesicles.
Immunocytochemistry/ Immunofluorescence: RASSF10 Antibody [NBP2-68639] - Staining of human cell line A549 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RASSF10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
RASSF10 Recombinant Protein Antigen (NBP2-68639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RASSF10 Antibody

  • Peptidylglycine Alpha-Amidating Monooxygenase COOH-Terminal Interactor-Like
  • Ras Association (RalGDS/AF-6) Domain Family (N-Terminal) Member 10
  • Ras Association Domain-Containing Protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RASSF1 Antibody
(OTI2B11)
NBP2-03644
Flow Cytometry: RASSF1 Antibody (2B11) [NBP2-03644] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RASSF1 antibody, and then analyzed by flow cytometry.
Western Blot: RASSF1 Antibody (2B11) [NBP2-03644] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RASSF1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RASSF1.
Immunohistochemistry-Paraffin: RASSF1 Antibody (2B11) [NBP2-03644] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-RASSF1 mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RASSF6 Antibody
NBP2-55145
Immunocytochemistry/Immunofluorescence: RASSF6 Antibody [NBP2-55145] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Western Blot: RASSF6 Antibody [NBP2-55145] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: RASSF6 Antibody [NBP2-55145] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RASSF2 Antibody
[Unconjugated]
AF5639
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, CEM human T‑lymphoblastoid cell line, and Daudi human Burkitt's lymphoma cell line . PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse RASSF2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5639) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for RASSF2 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
RASSF2 was detected in immersion fixed U937 human histiocytic lymphoma cell line using Goat Anti-Human/Mouse RASSF2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5639) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu
Applications: ICC, WB
RASSF3 Antibody
NBP1-89425
Western Blot: RASSF3 Antibody [NBP1-89425] - Analysis in control (vector only transfected HEK293T lysate) and RASSF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: RASSF3 Antibody [NBP1-89425] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: RASSF3 Antibody [NBP1-89425] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RASSF7 Antibody
NBP2-88128
Immunohistochemistry: RASSF7 Antibody [NBP2-88128] - Human kidney
Western Blot: RASSF7 Antibody [NBP2-88128] - Host: Rabbit. Target Name: RASSF7. Sample Tissue: Human A549. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: RASSF7 Antibody [NBP2-88128] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Species: Hu
Applications: IHC, IHC-P, WB
NORE1 Antibody -
BSA Free
NB500-248
Western Blot: NORE1 Antibody [NB500-248] - Analysis of NORE1 using this antibody at 1:1000 dilution on 293 T cell lysates overexpressed with NORE1.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RASSF4 Antibody
NBP1-89249
Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human kidney shows strong nuclear postivity in glomeruli.
Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RIN2 Antibody
NBP2-20163
Western Blot: RIN2 Antibody [NBP2-20163] - Sample (30 ug of whole cell lysate) A: HepG2 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RIN2 Antibody [NBP2-20163] - U87 xenograft. RIN2 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunocytochemistry/Immunofluorescence: RIN2 Antibody [NBP2-20163] - Confocal immunofluorescence analysis of methanol-fixed HeLa, using RIN2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PAMCI Antibody
NBP1-80938
Immunohistochemistry: PAMCI Antibody [NBP1-80938] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Western Blot: PAMCI Antibody [NBP1-80938] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: PAMCI Antibody [NBP1-80938] - Analysis using Anti-RASSF9 antibody NBP1-80938 (A) shows similar pattern to independent antibody NBP1-80937 (B).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
KIBRA Antibody -
BSA Free
NBP2-82101
Western Blot: KIBRA Antibody [NBP2-82101] - Analysis of KIBRA in human brain tissue lysate with KIBRA antibody at 1 ug/ml in (A) the absence and (B) the presence of blocking peptide.
Immunohistochemistry-Paraffin: KIBRA Antibody [NBP2-82101] - Mouse brain tissue with KIBRA antibody at 5 ug/ml.
Immunocytochemistry/Immunofluorescence: KIBRA Antibody [NBP2-82101] - Mouse brain tissue with KIBRA antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
(6 Publications)
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
CD38 Antibody
(1G7F4) - BSA Free
NBP2-25250
Immunohistochemistry-Frozen: CD38 Antibody (1G7F4) [NBP2-25250] - B cell lymphoma tumor sections (Ramos). Antibody Dilution 1:200. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: CD38 Antibody (1G7F4) [NBP2-25250] - HuH-7 cells (human liver cancer cell line) stained with Alexa Fluor 647 conjugated CD38 antibody. Image using the Alexa Fluor 647 format of this antibody. ICC/IF image submitted by a verified customer review.
Western Blot: CD38 Antibody (1G7F4) [NBP2-25250] - Analysis of (A) Human Jurkat, (B) Human Ramos and (C) Mouse EL4 lysate using this antibody at 4 ug/mL.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CRB3 Antibody
NBP1-81185
Immunocytochemistry/Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Isocitrate
Dehydrogenase 1/IDH1 ...
NBP1-47804
Knockout Validated: Isocitrate Dehydrogenase 1/IDH1 Antibody (OTI2H9) [NBP1-47804] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and IDH1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:2,000 of Mouse Anti-Human IDH1 monoclonal Antibody (Catalog # NBP1-47804) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for IHD1 at approximately 38 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: Isocitrate Dehydrogenase 1/IDH1 Antibody (OTI2H9) [NBP1-47804] - Isocitrate Dehydrogenase 1/IDH1 Antibody (2H9) [NBP1-47804] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Isocitrate dehydrogenase.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody (2H9) [NBP1-47804] - Staining of paraffin-embedded breast tissue using anti-Isocitrate dehydrogenase mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
BLOC1S2 Antibody
NBP3-05039
Western Blot: BLOC1S2 Antibody [NBP3-05039] - Analysis of extracts of various cell lines, using BLOC1S2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit
Species: Hu, Mu, Rt
Applications: IHC, WB
RASSF8 Antibody
(2G1)
H00011228-M01
Western Blot: RASSF8 Antibody (2G1) [H00011228-M01] - RASSF8 monoclonal antibody (M01), clone 2G1 Western Blot analysis of RASSF8 expression in HeLa ( Cat # L013V1 ).
Western Blot: RASSF8 Antibody (2G1) [H00011228-M01] - RASSF8 monoclonal antibody (M01), clone 2G1. Western Blot analysis of RASSF8 expression in PC-12(Cat # L012V1 ).
Western Blot: RASSF8 Antibody (2G1) [H00011228-M01] - RASSF8 expression in NIH/3T3(Cat # L018V1 ).
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Publications for RASSF10 Antibody (NBP2-68639) (0)

There are no publications for RASSF10 Antibody (NBP2-68639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF10 Antibody (NBP2-68639) (0)

There are no reviews for RASSF10 Antibody (NBP2-68639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASSF10 Antibody (NBP2-68639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF10 Products

Bioinformatics Tool for RASSF10 Antibody (NBP2-68639)

Discover related pathways, diseases and genes to RASSF10 Antibody (NBP2-68639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF10 Antibody (NBP2-68639)

Discover more about diseases related to RASSF10 Antibody (NBP2-68639).
 

Pathways for RASSF10 Antibody (NBP2-68639)

View related products by pathway.

PTMs for RASSF10 Antibody (NBP2-68639)

Learn more about PTMs related to RASSF10 Antibody (NBP2-68639).
 

Research Areas for RASSF10 Antibody (NBP2-68639)

Find related products by research area.

Blogs on RASSF10

There are no specific blogs for RASSF10, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF10 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RASSF10