RAR gamma/NR1B3 Antibody

Images

 
Western Blot: RAR gamma/NR1B3 Antibody [H00005916-B01P] - Analysis of RARG expression in transfected 293T cell line by RARG polyclonal antibody. Lane 1: RARG transfected lysate(49.94 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAR gamma/NR1B3 Antibody Summary

Immunogen
RARG (AAH19098, 1 a.a. - 454 a.a.) full-length human protein. MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Specificity
RARG - retinoic acid receptor, gamma,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RARG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAR gamma/NR1B3 Antibody

  • NR1B3
  • NR1B3RARC
  • Nuclear receptor subfamily 1 group B member 3
  • RAR gamma
  • RARC
  • RARG
  • RAR-gamma
  • retinoic acid receptor gamma
  • retinoic acid receptor, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA

Publications for RAR gamma/NR1B3 Antibody (H00005916-B01P) (0)

There are no publications for RAR gamma/NR1B3 Antibody (H00005916-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAR gamma/NR1B3 Antibody (H00005916-B01P) (0)

There are no reviews for RAR gamma/NR1B3 Antibody (H00005916-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAR gamma/NR1B3 Antibody (H00005916-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAR gamma/NR1B3 Products

Bioinformatics Tool for RAR gamma/NR1B3 Antibody (H00005916-B01P)

Discover related pathways, diseases and genes to RAR gamma/NR1B3 Antibody (H00005916-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAR gamma/NR1B3 Antibody (H00005916-B01P)

Discover more about diseases related to RAR gamma/NR1B3 Antibody (H00005916-B01P).
 

Pathways for RAR gamma/NR1B3 Antibody (H00005916-B01P)

View related products by pathway.

Research Areas for RAR gamma/NR1B3 Antibody (H00005916-B01P)

Find related products by research area.

Blogs on RAR gamma/NR1B3

There are no specific blogs for RAR gamma/NR1B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAR gamma/NR1B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARG
Entrez