RAP74 Antibody

Images

 
Western Blot: RAP74 Antibody [NBP1-89922] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-459
Immunocytochemistry/ Immunofluorescence: RAP74 Antibody [NBP1-89922] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & microtubules.
Immunohistochemistry-Paraffin: RAP74 Antibody [NBP1-89922] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: RAP74 Antibody [NBP1-89922] - Staining of human cell line U-2 OS shows positivity in nucleus and cytoskeleton (microtubules).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAP74 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2F2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAP74 Recombinant Protein Antigen (NBP1-89922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAP74 Antibody

  • BTF4
  • EC 3.6.1
  • EC 3.6.4.12
  • General transcription factor IIF 30 kDa subunit
  • general transcription factor IIF subunit 2
  • general transcription factor IIF, polypeptide 1 (74kD subunit)
  • general transcription factor IIF, polypeptide 2, 30kDa
  • RAP30ATP-dependent helicase GTF2F2
  • TF2F2
  • TFIIF
  • TFIIF-beta
  • Transcription initiation factor IIF subunit beta
  • Transcription initiation factor RAP30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
NBP2-16760
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00009150-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP1-89922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAP74 Antibody (NBP1-89922) (0)

There are no publications for RAP74 Antibody (NBP1-89922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP74 Antibody (NBP1-89922) (0)

There are no reviews for RAP74 Antibody (NBP1-89922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAP74 Antibody (NBP1-89922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAP74 Products

Bioinformatics Tool for RAP74 Antibody (NBP1-89922)

Discover related pathways, diseases and genes to RAP74 Antibody (NBP1-89922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RAP74 Antibody (NBP1-89922)

View related products by pathway.

Blogs on RAP74

There are no specific blogs for RAP74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAP74 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2F2