RALGPS2 Antibody

Images

 
Western Blot: RALGPS2 Antibody [NBP1-84646] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry-Paraffin: RALGPS2 Antibody [NBP1-84646] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RALGPS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALGPS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RALGPS2 Protein (NBP1-84646PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RALGPS2 Antibody

  • dJ595C2.1
  • FLJ10244
  • FLJ25604
  • KIAA0351
  • Ral GEF with PH domain and SH3 binding motif 2
  • Ral GEF with PH domain and SH3-binding motif 2
  • RalA exchange factor RalGPS2
  • Ral-A exchange factor RalGPS2
  • ras-specific guanine nucleotide-releasing factor RalGPS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-57057
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4208
Species: Rt
Applications: WB
AF7318
Species: Hu
Applications: IHC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
640-A3
Species: Mu
AF5480
Species: Hu
Applications: IHC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP1-90530
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-84646
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for RALGPS2 Antibody (NBP1-84646) (0)

There are no publications for RALGPS2 Antibody (NBP1-84646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALGPS2 Antibody (NBP1-84646) (0)

There are no reviews for RALGPS2 Antibody (NBP1-84646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RALGPS2 Antibody (NBP1-84646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RALGPS2 Products

Bioinformatics Tool for RALGPS2 Antibody (NBP1-84646)

Discover related pathways, diseases and genes to RALGPS2 Antibody (NBP1-84646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RALGPS2 Antibody (NBP1-84646)

Discover more about diseases related to RALGPS2 Antibody (NBP1-84646).
 

Pathways for RALGPS2 Antibody (NBP1-84646)

View related products by pathway.

Research Areas for RALGPS2 Antibody (NBP1-84646)

Find related products by research area.

Blogs on RALGPS2

There are no specific blogs for RALGPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALGPS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGPS2