![Western Blot: RALGPS2 Antibody [H00055103-D01P] - Analysis of RALGPS2 expression in transfected 293T cell line by RALGPS2 polyclonal antibody.Lane 1: RALGPS2 transfected lysate(31.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RALGPS2-Antibody-Western-Blot-H00055103-D01P-img0002.jpg "Western Blot: RALGPS2 Antibody [H00055103-D01P] - Analysis of RALGPS2 expression in transfected 293T cell line by RALGPS2 polyclonal antibody.Lane 1: RALGPS2 transfected lysate(31.90 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit RALGPS2 Antibody - Azide and BSA Free (H00055103-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | RALGPS2 (NP_060507.1, 1 a.a. - 279 a.a.) full-length human protein. MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYK |
| Specificity | RALGPS2 - Ral GEF with PH domain and SH3 binding motif 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RALGPS2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Immunohistochemistry_12988.jpg)
![Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Flow_Cytometry_23901.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RALGPS2 Antibody (H00055103-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot RalA/RalB Antibody [Unconjugated]](https://images.novusbio.com/images2/RalB_AF3204_Western_Blot_5254.jpg)
![N/A RalA/RalB Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3204_human-mouse-rat-rala-b-affinity-purified-polyclonal-ab-332025111359..jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")