RalB Antibody

Images

 
Western Blot: RalB Antibody [H00005899-B01P] - Analysis of RALB expression in human placenta.
Western Blot: RalB Antibody [H00005899-B01P] - Analysis of RALB expression in transfected 293T cell line by RALB polyclonal antibody. Lane 1: RALB transfected lysate(22.66 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RalB Antibody Summary

Immunogen
RALB (NP_002872.1, 1 a.a. - 206 a.a.) full-length human protein. MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
Specificity
RALB - v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RALB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RalB Antibody

  • GTP binding protein
  • RalB
  • RAS-like protein B
  • ras-related protein Ral-B
  • v-ral simian leukemia viral oncogene homolog B (ras related; GTP bindingprotein)

Background

This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91444
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for RalB Antibody (H00005899-B01P) (0)

There are no publications for RalB Antibody (H00005899-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RalB Antibody (H00005899-B01P) (0)

There are no reviews for RalB Antibody (H00005899-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RalB Antibody (H00005899-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RalB Products

Bioinformatics Tool for RalB Antibody (H00005899-B01P)

Discover related pathways, diseases and genes to RalB Antibody (H00005899-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RalB Antibody (H00005899-B01P)

Discover more about diseases related to RalB Antibody (H00005899-B01P).
 

Pathways for RalB Antibody (H00005899-B01P)

View related products by pathway.

PTMs for RalB Antibody (H00005899-B01P)

Learn more about PTMs related to RalB Antibody (H00005899-B01P).
 

Research Areas for RalB Antibody (H00005899-B01P)

Find related products by research area.

Blogs on RalB

There are no specific blogs for RalB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RalB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALB
Entrez
Uniprot