Rad21 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Rad21 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rad21
  
  

  Source: E.coli

  Amino Acid Sequence: MDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RAD21
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25089It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad21 Recombinant Protein Antigen

• double-strand-break repair protein rad21 homolog
• hHR21FLJ25655
• HR21
• KIAA0078RAD21 (S. pombe) homolog
• MCD1
• Nuclear matrix protein 1
• NXP-1
• NXP1HRAD21
• protein involved in DNA double-strand break repair
• RAD21 homolog (S. pombe)
• SCC1 homolog
• SCC1FLJ40596

Background

The cohesin complex plays an important role in tethering sister chromatids during the prophase through anaphase stages of mitosis, making certain that genomic information is replicated accurately. As the cellular division process continues, separase destroys the cohesin complex by means of cleavaging its Scc1 subunit (Mcd1/Scc1/hRad21), allowing the chromatids to separate and divide with the cell. During apoptosis the C-terminal portion of hRad21 is cleaved and translocated to the cytoplasm. This cleavage and translocation may act as a nuclear signal that promotes and accelerates subsequent events of apoptosis (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAD21