Rad21 Recombinant Protein Antigen

Images

 
There are currently no images for Rad21 Protein (NBP1-83260PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rad21 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD21.

Source: E. coli

Amino Acid Sequence: KLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD21
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83260.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad21 Recombinant Protein Antigen

  • double-strand-break repair protein rad21 homolog
  • hHR21FLJ25655
  • HR21
  • KIAA0078RAD21 (S. pombe) homolog
  • MCD1
  • Nuclear matrix protein 1
  • NXP-1
  • NXP1HRAD21
  • protein involved in DNA double-strand break repair
  • RAD21 homolog (S. pombe)
  • SCC1 homolog
  • SCC1FLJ40596

Background

The cohesin complex plays an important role in tethering sister chromatids during the prophase through anaphase stages of mitosis, making certain that genomic information is replicated accurately. As the cellular division process continues, separase destroys the cohesin complex by means of cleavaging its Scc1 subunit (Mcd1/Scc1/hRad21), allowing the chromatids to separate and divide with the cell. During apoptosis the C-terminal portion of hRad21 is cleaved and translocated to the cytoplasm. This cleavage and translocation may act as a nuclear signal that promotes and accelerates subsequent events of apoptosis (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Ce, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-87144
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20287
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-300
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-85110
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00114799-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF6820
Species: Mu, Rt
Applications: IHC, WB
NBP1-87097
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16012
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76420
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, mIF, Simple Western, WB
NBP2-38313
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-83260PEP
Species: Hu
Applications: AC

Publications for Rad21 Protein (NBP1-83260PEP) (0)

There are no publications for Rad21 Protein (NBP1-83260PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad21 Protein (NBP1-83260PEP) (0)

There are no reviews for Rad21 Protein (NBP1-83260PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad21 Protein (NBP1-83260PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad21 Products

Research Areas for Rad21 Protein (NBP1-83260PEP)

Find related products by research area.

Blogs on Rad21

There are no specific blogs for Rad21, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad21 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD21