Recombinant Human RABL2B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RABL2B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-229 of Human RABL2B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS

Protein/Peptide Type
Recombinant Protein
Gene
RABL2B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RABL2B Protein

  • FLJ93981
  • FLJ98216
  • RAB, member of RAS oncogene family-like 2B
  • rab-like protein 2B

Background

RABL2B( AAH14879, 1 a.a. - 230 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45513
Species: Hu
Applications: WB, IHC
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-04508
Species: Hu
H00007290-B01P
Species: Hu
Applications: WB, ICC/IF
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1212
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P

Publications for RABL2B Recombinant Protein (H00011158-P01) (0)

There are no publications for RABL2B Recombinant Protein (H00011158-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABL2B Recombinant Protein (H00011158-P01) (0)

There are no reviews for RABL2B Recombinant Protein (H00011158-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABL2B Recombinant Protein (H00011158-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RABL2B Products

Bioinformatics Tool for RABL2B Recombinant Protein (H00011158-P01)

Discover related pathways, diseases and genes to RABL2B Recombinant Protein (H00011158-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABL2B Recombinant Protein (H00011158-P01)

Discover more about diseases related to RABL2B Recombinant Protein (H00011158-P01).
 

Pathways for RABL2B Recombinant Protein (H00011158-P01)

View related products by pathway.

Research Areas for RABL2B Recombinant Protein (H00011158-P01)

Find related products by research area.

Blogs on RABL2B

There are no specific blogs for RABL2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RABL2B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RABL2B