RABIF/MSS4 Antibody (3A6)

Images

 
Sandwich ELISA: RABIF/MSS4 Antibody (3A6) [H00005877-M03] - Detection limit for recombinant GST tagged RABIF is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RABIF/MSS4 Antibody (3A6) Summary

Immunogen
RABIF (AAH18488, 1 a.a. - 123 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Specificity
RABIF - RAB interacting factor (3A6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RABIF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RABIF/MSS4 Antibody (3A6)

  • mammalian suppressor of SEC4
  • mss4
  • MSS4guanine nucleotide exchange factor MSS4
  • RAB interacting factor
  • Rab-interacting factor
  • RASGFR3
  • RASGRF3
  • Ras-specific guanine-releasing factor 3

Background

The Sec4/Rab-related small GTP-binding proteins are involved in the regulation of intracellular vesicular transport. Mss4 stimulates GTP-GDP exchange in Sec4 and Rab and binds to a subset of genetically related Rab proteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00005877-M03
Species: Hu
Applications: WB, ELISA

Publications for RABIF/MSS4 Antibody (H00005877-M03) (0)

There are no publications for RABIF/MSS4 Antibody (H00005877-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABIF/MSS4 Antibody (H00005877-M03) (0)

There are no reviews for RABIF/MSS4 Antibody (H00005877-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABIF/MSS4 Antibody (H00005877-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RABIF/MSS4 Products

Bioinformatics Tool for RABIF/MSS4 Antibody (H00005877-M03)

Discover related pathways, diseases and genes to RABIF/MSS4 Antibody (H00005877-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABIF/MSS4 Antibody (H00005877-M03)

Discover more about diseases related to RABIF/MSS4 Antibody (H00005877-M03).
 

Pathways for RABIF/MSS4 Antibody (H00005877-M03)

View related products by pathway.

Research Areas for RABIF/MSS4 Antibody (H00005877-M03)

Find related products by research area.

Blogs on RABIF/MSS4

There are no specific blogs for RABIF/MSS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RABIF/MSS4 Antibody (3A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RABIF
Entrez
Uniprot