Recombinant Human RABGAP1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RABGAP1L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human RABGAP1L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RABGAP1L
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RABGAP1L Protein

  • DKFZp686E1450
  • FLJ58037
  • FLJ79118
  • heart, liver (HLL)
  • HHLFLJ79254
  • RAB GTPase activating protein 1-like
  • rab GTPase-activating protein 1-like
  • TBC1 domain family, member 18
  • TBC1D18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-70510
Species: Hu
Applications: WB
H00022800-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009910-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RABGAP1L Partial Recombinant Protein (H00009910-Q01) (0)

There are no publications for RABGAP1L Partial Recombinant Protein (H00009910-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABGAP1L Partial Recombinant Protein (H00009910-Q01) (0)

There are no reviews for RABGAP1L Partial Recombinant Protein (H00009910-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABGAP1L Partial Recombinant Protein (H00009910-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RABGAP1L Products

Bioinformatics Tool for RABGAP1L Partial Recombinant Protein (H00009910-Q01)

Discover related pathways, diseases and genes to RABGAP1L Partial Recombinant Protein (H00009910-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABGAP1L Partial Recombinant Protein (H00009910-Q01)

Discover more about diseases related to RABGAP1L Partial Recombinant Protein (H00009910-Q01).
 

Pathways for RABGAP1L Partial Recombinant Protein (H00009910-Q01)

View related products by pathway.

PTMs for RABGAP1L Partial Recombinant Protein (H00009910-Q01)

Learn more about PTMs related to RABGAP1L Partial Recombinant Protein (H00009910-Q01).

Blogs on RABGAP1L

There are no specific blogs for RABGAP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RABGAP1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RABGAP1L