![Western Blot: RABEP1 Antibody (3H6) [H00009135-M06] - Analysis of RABEP1 expression in HepG2 (Cat # L019V1).](http://images.novusbio.com/fullsize/RABEP1-Antibody-3H6-Western-Blot-H00009135-M06-img0003.jpg "Western Blot: RABEP1 Antibody (3H6) [H00009135-M06] - Analysis of RABEP1 expression in HepG2 (Cat # L019V1).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3H6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RABEP1 (NP_004694.2, 765 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET |
| Specificity | Reacts with rabaptin, RAB GTPase binding effector protein 1. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RABEP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: RABEP1 Antibody (3H6) [H00009135-M06] - Detection limit for recombinant GST tagged RABEP1 is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RABEP1-Antibody-3H6-Sandwich-ELISA-H00009135-M06-img0002.jpg "Sandwich ELISA: RABEP1 Antibody (3H6) [H00009135-M06] - Detection limit for recombinant GST tagged RABEP1 is 3 ng/ml as a capture antibody.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")