Rabenosyn 5 Antibody

Images

 
Western Blot: Rabenosyn 5 Antibody [NBP2-88120] - WB Suggested Anti-ZFYVE20 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Stomach

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rabenosyn 5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Rabenosyn 5. Peptide sequence: MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Porcine (93%), Bovine (93%), Rabbit (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
RBSN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rabenosyn 5 Antibody

  • 110 kDa protein
  • FLJ34993
  • FYVE finger-containing Rab5 effector protein rabenosyn-5
  • FYVE-finger-containing Rab5 effector protein rabenosyn-5
  • MGC126210
  • Rabenosyn-5
  • ZFYVE20
  • Zinc finger FYVE domain-containing protein 20
  • zinc finger, FYVE domain containing 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-36568
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP2-66907
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
NB100-74519
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-98931
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IHC-WhMt, KD
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56035
Species: Hu
Applications: WB, ICC/IF, KO
NBP2-75670
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no publications for Rabenosyn 5 Antibody (NBP2-88120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no reviews for Rabenosyn 5 Antibody (NBP2-88120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rabenosyn 5 Products

Bioinformatics Tool for Rabenosyn 5 Antibody (NBP2-88120)

Discover related pathways, diseases and genes to Rabenosyn 5 Antibody (NBP2-88120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rabenosyn 5 Antibody (NBP2-88120)

Discover more about diseases related to Rabenosyn 5 Antibody (NBP2-88120).
 

Pathways for Rabenosyn 5 Antibody (NBP2-88120)

View related products by pathway.

PTMs for Rabenosyn 5 Antibody (NBP2-88120)

Learn more about PTMs related to Rabenosyn 5 Antibody (NBP2-88120).

Blogs on Rabenosyn 5

There are no specific blogs for Rabenosyn 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rabenosyn 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBSN