Home » Rabenosyn 5 » Rabenosyn 5 Antibodies » Rabenosyn 5 Antibody

Rabenosyn 5 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Rabenosyn 5 Antibody [NBP2-88120] - WB Suggested Anti-ZFYVE20 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Stomach
Western Blot: Rabenosyn 5 Antibody [NBP2-88120] - WB Suggested Anti-ZFYVE20 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Stomach

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Rabenosyn 5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Rabenosyn 5. Peptide sequence: MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Porcine (93%), Bovine (93%), Rabbit (93%), Canine (93%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
RBSN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rabenosyn 5 Antibody

  • 110 kDa protein
  • FLJ34993
  • FYVE finger-containing Rab5 effector protein rabenosyn-5
  • FYVE-finger-containing Rab5 effector protein rabenosyn-5
  • MGC126210
  • Rabenosyn-5
  • ZFYVE20
  • Zinc finger FYVE domain-containing protein 20
  • zinc finger, FYVE domain containing 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - analysis of Human Cell line lysates showing detection of Rab5 protein using Rabbit Anti-Rab5 Polyclonal Antibody. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rab5a Antibody [NB120-13253] - Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:80 for 12 hours at 4C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 2 hours at RT. Localization: Cytoplasm. Melanosome. Nucleus. Magnification: 100x.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
EEA1 Antibody
(6D4.1D4)
NBP2-36568
Western Blot: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of partial recombinant human EEA1 protein (14kDa) with EEA1 antibody clone 6D4.1D4 at 0.5 ug mL.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-IC
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
CDP/CUTL1 Antibody
NBP2-13883
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Insulysin/IDE
Antibody (JJ0949)
NBP2-66907
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on hybrid fish (crucian-carp) heart tissue lysate using anti-Insulin degrading enzyme antibody at 1/500 dilution.
Immunohistochemistry-Paraffin: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of mouse colon tissue using anti-Insulin degrading enzyme antibody. Counter stained with hematoxylin.
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on different lysates using anti-Insulin degrading enzyme antibody at 1/1,000 dilution. Positive control: Lane 1: zebrafish Lane 2: Hela Lane 3: K562
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P
Cathepsin D
Antibody [Unconjugate
AF1029
Cathepsin D Antibody [Unconjugated]
(2 Reviews)
(14 Publications)
Species: Mu
Applications: WB, IHC, IP, ICC
Rab4 Antibody
NB100-74519
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in NIH-3T3 Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:20 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: Rab4 Antibody [NB100-74519] - Immunohistochemistry was performed on normal deparaffinized human Stomach tissue.
Immunocytochemistry/Immunofluorescence: Rab4 Antibody [NB100-74519] - in HeLa Cells. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a RAB4 polyclonal antibody at a dilution of 1:100 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
RAB6A Antibody
NBP1-33110
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
SART3 Antibody
NB100-74648
Western Blot: SART3 Antibody [NB100-74648] - Detection of Human SART3/TIP110 on HeLa whole cell lysate using NB100-74648. SART3 was also immunoprecipitated by rabbit anti-SART3 antibody NB100-74649.
Immunocytochemistry/Immunofluorescence: SART3 Antibody [NB100-74648] - FFPE section of human pancreatic islet cell tumor. Affinity purified rabbit anti-SART3 used at a dilution of 1:100. Detection: Red fluorescent goat anti-rabbit IgG highly cross-adsorbed Antibody Hilyte PlusTM 555 used at a dilution of 1:100.
Immunohistochemistry: SART3 Antibody [NB100-74648] - Sample: FFPE sections of human ovarian carcinoma (left) and colon carcinoma (right). Antibody: Affinity purified rabbit anti- SART3/TIP110 used at a dilution of 1:200 (1ug/ml) and 1:400 (0.5 ug/ml). Detection: DAB and Red-fluorescent Goat anti-Rabbit IgG
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
VPS45 Antibody
NB100-98931
Immunohistochemistry-Paraffin: VPS45 Antibody [NB100-98931] - IHC-P on paraffin sections of rat DRG.The animal was perfused using Autoperfuser at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min.Blocking: 0.2% LFDM in TBST filtered thru 0.2 um.Detection was done using HRP polymer from manufacturers instructions; DAB chromogen.Primary antibody: dilution 1: 1000, incubated 30 min at RT using Autostainer.Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: VPS45 Antibody [NB100-98931] - Rat spinal cord using Rabbit antibody to internal part of Vacuolar protein sorting-associated protein 45 (rvps45, Vps45, Vps45a): IgG at a concentration of 10 ug/ml.
Immunohistochemistry-Paraffin: VPS45 Antibody [NB100-98931] - IHC-P on paraffin sections of rat brain. The animal was perfused using Autoperfuser at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. DAB chromogen. Primary antibody: dilution 1: 1000, incubated 30 min at RT using Autostainer. Sections were counterstained with Harris Hematoxylin
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
(1 Publication)
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
Nucleolin Antibody
NB600-241
Immunocytochemistry/Immunofluorescence: Nucleolin Antibody [NB600-241] - Analysis of Nucleolin MCF-7 breast cancer cells. Image courtsey of product review by Lacey Litchfield.
Simple Western: Nucleolin Antibody [NB600-241] - Image shows a specific band for Nucleolin in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: Nucleolin Antibody [NB600-241] - Endogenous nuclear nucleolin-COUP-TFII interaction in MCF-7 and T47D cells.NE (200A ug protein) from MCF-7 cells. Immunofluorescent staining of endogenous COUP-TFII (green) and nucleolin (red) in the nuclei (Hoechst, blue) of MCF-7 cells. Merged images are shown at the right. Bar is 10A um. Image collected and cropped by Cite Ab from the following publication (Identification and characterization of nucleolin as a COUP-TFII coactivator of retinoic acid receptor transcription in breast cancer cells. PLoS One (2012) licensed under a CC-BY licence.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IHC-WhMt, KD
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
EHD1 Antibody
NBP2-56035
Western Blot: EHD1 Antibody [NBP2-56035] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: EHD1 Antibody [NBP2-56035] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, KO
SNX1 Antibody
(JG40-06)
NBP2-75670
Western Blot: SNX1 Antibody (JG40-06) [NBP2-75670] - Analysis of SNX1 on human skin tissue lysate using anti-SNX1 antibody at 1/2,000 dilution.
Immunocytochemistry/Immunofluorescence: SNX1 Antibody (JG40-06) [NBP2-75670] - Staining SNX1 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: SNX1 Antibody (JG40-06) [NBP2-75670] - Analysis of paraffin-embedded rat epididymis tissue using anti-SNX1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Progesterone
R/NR3C3 Antibody (4E9
H00005241-M08
Western Blot: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of PGR expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/Immunofluorescence: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on MCF-7 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ARF1 Antibody (1D9)
NB300-505
Western Blot: ARF1 Antibody (1D9) [NB300-505] - Analysis of canine heart extract.
Immunocytochemistry/Immunofluorescence: ARF1 Antibody (1D9) [NB300-505] - Analysis of ADP-Ribosylation Factor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: ARF1 Antibody (1D9) [NB300-505] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(13 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Recombinant Human
OCA2 GST (N-Term) Pro ...
H00004948-Q01
SDS-Page: Recombinant Human OCA2 Protein [H00004948-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no publications for Rabenosyn 5 Antibody (NBP2-88120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no reviews for Rabenosyn 5 Antibody (NBP2-88120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rabenosyn 5 Antibody (NBP2-88120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Rabenosyn 5 Products

Bioinformatics Tool for Rabenosyn 5 Antibody (NBP2-88120)

Discover related pathways, diseases and genes to Rabenosyn 5 Antibody (NBP2-88120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rabenosyn 5 Antibody (NBP2-88120)

Discover more about diseases related to Rabenosyn 5 Antibody (NBP2-88120).
 

Pathways for Rabenosyn 5 Antibody (NBP2-88120)

View related products by pathway.

PTMs for Rabenosyn 5 Antibody (NBP2-88120)

Learn more about PTMs related to Rabenosyn 5 Antibody (NBP2-88120).

Blogs on Rabenosyn 5

There are no specific blogs for Rabenosyn 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rabenosyn 5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RBSN