New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » RAB6A » RAB6A Antibodies » RAB6A Antibody

RAB6A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RAB6A Antibody [NBP2-88117] - Host: Rabbit. Target Name: RAB6A. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: RAB6A Antibody [NBP2-88117] - Host: Rabbit. Target Name: RAB6A. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RAB6A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RAB6A. Peptide sequence: LNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB6A Antibody

  • GTP-binding protein RAB6A'
  • GTP-binding protein RAB6B
  • Oncogene RAB6
  • Rab GTPase
  • Rab-6
  • RAB6, member RAS oncogene family
  • Rab6A variant 3
  • RAB6A'
  • RAB6A, member RAS oncogene family
  • RAB6B
  • RAB6rab-6
  • ras-related protein Rab-6A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HIV-1 Rev binding
protein Antibody
NBP1-91991
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rab1A Antibody
NBP1-55113
Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: Rab1A Antibody [NBP1-55113] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Human Bronchial Epithelial Tissue. Observed Staining: Cytoplasmic staining with Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
Rab5a Antibody
NB120-13253
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody . Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
Western Blot: Rab5a Antibody [NB120-13253] - analysis of Human Cell line lysates showing detection of Rab5 protein using Rabbit Anti-Rab5 Polyclonal Antibody . Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rab5a Antibody [NB120-13253] - Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:80 for 12 hours at 4C. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:200 for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 2 hours at RT. Localization: Cytoplasm. Melanosome. Nucleus. Magnification: 20x.
(2 Reviews)
(13 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
RAB8A Antibody
(3G1)
H00004218-M02
Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.
ELISA: RAB8A Antibody (3G1) [H00004218-M02] - Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
(1 Review)
(9 Publications)
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
Rab11A Antibody
NBP2-49320
Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RAB7B Antibody
(3B3)
H00338382-M01
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: RAB7B Antibody (3B3) [H00338382-M01] - Monoclonal antibody to RAB7B ( Cat # H00338382-M01 ) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Immunocytochemistry/Immunofluorescence: RAB7B Antibody (3B3) [H00338382-M01] - Monoclonal antibody to RAB7B (H00338382-M01) on HeLa cell . [antibody concentration 10 ug/ml]
(2 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Rab7a Antibody
NBP1-87174
Immunocytochemistry/Immunofluorescence: Rab7a Antibody [NBP1-87174] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining is shown in green.
Western Blot: Rab7a Antibody [NBP1-87174] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Rab7a Antibody [NBP1-87174] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Rab4 Antibody
(4E11) - BSA Free
NBP2-37485
ELISA: Rab4 Antibody (4E11) [NBP2-37485] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mAb against human RAB4A (AA: 22-218) recombinant protein. (Expected MW is 47.9 kDa)
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mouse mAb against Jurkat (1), HeLa (2), A549 (3), HEK293 (4), K562 (5), NIH3T3 (6), PC-12 (7), and COS7 (8) cell lysate.
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Rab2 Antibody
NBP1-31480
Immunohistochemistry-Paraffin: Rab2 Antibody [NBP1-31480] - N87 xenograft, using RAB2A antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Rab2 Antibody [NBP1-31480] - Analysis of NBP1-31480 on HeLa S3, with 12% SDS PAGE, diluted at 1:500.
Immunohistochemistry-Paraffin: Rab2 Antibody [NBP1-31480] - Human endo mitral OCVA , using RAB2A antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu
Applications: IHC, IHC-P, WB
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug GL261 whole cell lysate/extract C. 30 ug C8D30 whole cell lysate/extract D. 30 ug NIH-3T3 whole cell lysate/extract E. 30 ug BCL-1 whole cell lysate/extract F. 30 ug Raw 264.7 whole cell lysate/extract G. 30 ug C2Cl2 whole cell lysate/extract 5% SDS-PAGEGEF-H1 antibody dilution: 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Rab3A Antibody
(OTI1G3)
NBP2-45499
Western Blot: Rab3A Antibody (OTI1G3) [NBP2-45499] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RAB3A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RAB3A.
Immunohistochemistry-Paraffin: Rab3A Antibody (OTI1G3) [NBP2-45499] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-RAB3A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Rab3A Antibody (OTI1G3) [NBP2-45499] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-RAB3A mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Western Blot: Glut4 Antibody [NBP1-49533] - Glycolysis-related genes and proteins were upregulated in differentiated podocytes. Representative blot images of glycolysis-related proteins (n =3). d All proteins were normalized to tubulin and compared to UDPs. *P < 0.05, **P < 0.01, determined by t test. Data are shown as the means +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-020-2481-5), licensed under a CC-BY licence.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
VDP p115 Antibody
(3F4)
H00008615-M03
Immunocytochemistry/Immunofluorescence: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of monoclonal antibody to USO1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml
Western Blot: VDP p115 Antibody (3F4) [H00008615-M03] - Analysis of USO1 expression in HeLa (Cat # L013V1).
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
TBC1D4 Antibody
(OTI5E6) - Azide and ...
NBP2-74462
Western Blot: TBC1D4 Antibody (OTI5E6) - Azide and BSA Free [NBP2-74462] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TBC1D4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TBC1D4.
Flow Cytometry: TBC1D4 Antibody (OTI5E6) - Azide and BSA Free [NBP2-74462] - Analysis of Hela cells, using anti-TBC1D4 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: TBC1D4 Antibody (OTI5E6) - Azide and BSA Free [NBP2-74462] - Analysis of Jurkat cells, using anti-TBC1D4 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
RAB6A Antibody
NBP2-88117
RAB6A Antibody
Species: Hu
Applications: WB

Publications for RAB6A Antibody (NBP2-88117) (0)

There are no publications for RAB6A Antibody (NBP2-88117).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB6A Antibody (NBP2-88117) (0)

There are no reviews for RAB6A Antibody (NBP2-88117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB6A Antibody (NBP2-88117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB6A Products

Bioinformatics Tool for RAB6A Antibody (NBP2-88117)

Discover related pathways, diseases and genes to RAB6A Antibody (NBP2-88117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB6A Antibody (NBP2-88117)

Discover more about diseases related to RAB6A Antibody (NBP2-88117).
 

Pathways for RAB6A Antibody (NBP2-88117)

View related products by pathway.

PTMs for RAB6A Antibody (NBP2-88117)

Learn more about PTMs related to RAB6A Antibody (NBP2-88117).
 

Research Areas for RAB6A Antibody (NBP2-88117)

Find related products by research area.

Blogs on RAB6A

There are no specific blogs for RAB6A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB6A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB6A