New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

RAB6A Antibody

Images

 
Western Blot: RAB6A Antibody [NBP2-88117] - Host: Rabbit. Target Name: RAB6A. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB6A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RAB6A. Peptide sequence: LNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB6A Antibody

  • GTP-binding protein RAB6A'
  • GTP-binding protein RAB6B
  • Oncogene RAB6
  • Rab GTPase
  • Rab-6
  • RAB6, member RAS oncogene family
  • Rab6A variant 3
  • RAB6A'
  • RAB6A, member RAS oncogene family
  • RAB6B
  • RAB6rab-6
  • ras-related protein Rab-6A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00338382-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-31480
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
H00008615-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-74462
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
AF6260
Species: Hu
Applications: WB
NBP2-88117
Species: Hu
Applications: WB

Publications for RAB6A Antibody (NBP2-88117) (0)

There are no publications for RAB6A Antibody (NBP2-88117).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB6A Antibody (NBP2-88117) (0)

There are no reviews for RAB6A Antibody (NBP2-88117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB6A Antibody (NBP2-88117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB6A Products

Bioinformatics Tool for RAB6A Antibody (NBP2-88117)

Discover related pathways, diseases and genes to RAB6A Antibody (NBP2-88117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB6A Antibody (NBP2-88117)

Discover more about diseases related to RAB6A Antibody (NBP2-88117).
 

Pathways for RAB6A Antibody (NBP2-88117)

View related products by pathway.

PTMs for RAB6A Antibody (NBP2-88117)

Learn more about PTMs related to RAB6A Antibody (NBP2-88117).
 

Research Areas for RAB6A Antibody (NBP2-88117)

Find related products by research area.

Blogs on RAB6A

There are no specific blogs for RAB6A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB6A