RAB3B Antibody (1A7)

Images

 
Western Blot: RAB3B Antibody (1A7) [H00005865-M02] - Analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M02), clone 1A7.Lane 1: RAB3B transfected lysate(24.8 KDa).Lane 2: ...read more
Immunoprecipitation: RAB3B Antibody (1A7) [H00005865-M02] - Analysis of RAB3B transfected lysate using anti-RAB3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB3B MaxPab rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB3B Antibody (1A7) Summary

Immunogen
RAB3B (AAH05035, 120 a.a. - 219 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB3B Antibody (1A7)

  • brain antigen RAB3B
  • RAB3B, member RAS oncogene family
  • ras-related protein Rab-3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-32871
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP2-24510
Species: Hu, Ca, Pm
Applications: WB
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
AF3444
Species: Hu
Applications: WB
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for RAB3B Antibody (H00005865-M02) (0)

There are no publications for RAB3B Antibody (H00005865-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB3B Antibody (H00005865-M02) (0)

There are no reviews for RAB3B Antibody (H00005865-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB3B Antibody (H00005865-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB3B Products

Bioinformatics Tool for RAB3B Antibody (H00005865-M02)

Discover related pathways, diseases and genes to RAB3B Antibody (H00005865-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB3B Antibody (H00005865-M02)

Discover more about diseases related to RAB3B Antibody (H00005865-M02).
 

Pathways for RAB3B Antibody (H00005865-M02)

View related products by pathway.

PTMs for RAB3B Antibody (H00005865-M02)

Learn more about PTMs related to RAB3B Antibody (H00005865-M02).
 

Research Areas for RAB3B Antibody (H00005865-M02)

Find related products by research area.

Blogs on RAB3B

There are no specific blogs for RAB3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB3B Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3B
Uniprot