Rab3A Antibody (4H7)

Images

 
Western Blot: Rab3A Antibody (4H7) [H00005864-M01] - RAB3A monoclonal antibody (M01), clone 4H7 Analysis of RAB3A expression in IMR-32.
Immunocytochemistry/ Immunofluorescence: Rab3A Antibody (4H7) [H00005864-M01] - Analysis of monoclonal antibody to RAB3A on HeLa cell. Antibody concentration 25 ug/ml.
Sandwich ELISA: Rab3A Antibody (4H7) [H00005864-M01] - Detection limit for recombinant GST tagged RAB3A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rab3A Antibody (4H7) Summary

Immunogen
RAB3A (NP_002857, 122 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Specificity
RAB3A - RAB3A, member RAS oncogene family
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. IHC-P usage was reported in scientific literature.
Publications
Read Publication using
H00005864-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab3A Antibody (4H7)

  • RAB3A, member RAS oncogene family
  • RAS-associated protein RAB3A
  • ras-related protein Rab-3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-69184
Species: Mu, Rt
Applications: WB
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005865-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
NBP1-32871
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
H00004218-M02
Species: Hu
Applications: WB, ELISA
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005864-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Rab3A Antibody (H00005864-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Rab3A Antibody (H00005864-M01) (0)

There are no reviews for Rab3A Antibody (H00005864-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rab3A Antibody (H00005864-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab3A Products

Bioinformatics Tool for Rab3A Antibody (H00005864-M01)

Discover related pathways, diseases and genes to Rab3A Antibody (H00005864-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab3A Antibody (H00005864-M01)

Discover more about diseases related to Rab3A Antibody (H00005864-M01).
 

Pathways for Rab3A Antibody (H00005864-M01)

View related products by pathway.

PTMs for Rab3A Antibody (H00005864-M01)

Learn more about PTMs related to Rab3A Antibody (H00005864-M01).
 

Research Areas for Rab3A Antibody (H00005864-M01)

Find related products by research area.

Blogs on Rab3A

There are no specific blogs for Rab3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab3A Antibody (4H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB3A
Entrez
OMIM
Uniprot