After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Genetic Strategies: Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs induce muscle catabolism in myotubes. Hsp70/90 release by cachexia-inducing tumor cells is dependent on ...read more
Western Blot: RAB27B Antibody [NBP1-79631] - Rab27b Antibody Titration: 0.5 ug/ml Positive Control: human testis, mouse liver, brain and testis
Western Blot: RAB27B Antibody [NBP1-79631] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%
Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs are critical to the development of muscle wasting in mice. a Elevation of serum Hsp70/90 in LLC tumor-bearing mice is dependent on ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen for this antibody is Rab27b. Peptide sequence YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB27B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-79631 in the following applications:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for RAB27B Antibody - BSA Free
C25KG
RAB27B, member RAS oncogene family
ras-related protein Rab-27B
Background
RAB27B may be involved in targeting uroplakins to urothelial apical membranes
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RAB27B Antibody - BSA Free and receive a gift card or discount.