RAB27B Antibody

Images

 
Western Blot: RAB27B Antibody [H00005874-B01P] - Analysis of RAB27B expression in transfected 293T cell line by RAB27B polyclonal antibody. Lane 1: RAB27B transfected lysate(24.09 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RbSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB27B Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
RAB27B (AAH27474, 1 a.a. - 218 a.a.) full-length human protein. MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Specificity
RAB27B - RAB27B, member RAS oncogene family,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RAB27B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ICC/IF usage was reported in scientific literature.
Reviewed Applications
Read 2 Reviews rated 4
using
H00005874-B01P in the following applications:

Publications
Read Publications using
H00005874-B01P in the following applications:

Reactivity Notes

Rabbit reactivity reported from customer review.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB27B Antibody

  • C25KG
  • RAB27B, member RAS oncogene family
  • ras-related protein Rab-27B

Background

RAB27B may be involved in targeting uroplakins to urothelial apical membranes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB27B Antibody (H00005874-B01P)(2)

We have publications tested in 1 confirmed species: Rabbit.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Rabbit
(1)
All Species

Reviews for RAB27B Antibody (H00005874-B01P) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Other.

Reviews using H00005874-B01P:
Filter by Applications
ICC
(1)
WB
(1)
All Applications
Filter by Species
Other
(2)
All Species
Images Ratings Applications Species Date Details
  3
reviewed by:
Verified Customer
ICC Other 05/27/2009
View

Summary

ApplicationImmunocytochemistry
Sample TestedRabbit LG
SpeciesOther
  5
reviewed by:
Verified Customer
WB Other 05/27/2009
View

Summary

ApplicationWestern Blot
Sample TestedRabbit LG Tissue
SpeciesOther
Lot08249WULz

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB27B Antibody (H00005874-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB27B Products

Research Areas for RAB27B Antibody (H00005874-B01P)

Find related products by research area.

Blogs on RAB27B

There are no specific blogs for RAB27B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
1
4
0
3
1
2
0
1
0

 
Verified Customer
05/27/2009
Application: ICC
Species: Other

 
Verified Customer
05/27/2009
Application: WB
Species: Other

Bioinformatics

Gene Symbol RAB27B
Entrez
Uniprot