RAB27B Antibody

Western Blot: RAB27B Antibody [H00005874-B01P] - Analysis of RAB27B expression in transfected 293T cell line by RAB27B polyclonal antibody. Lane 1: RAB27B transfected lysate(24.09 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rb
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

RAB27B Antibody Summary

• Immunogen: RAB27B (AAH27474, 1 a.a. - 218 a.a.) full-length human protein. MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
• Specificity: RAB27B - RAB27B, member RAS oncogene family,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RAB27B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ICC/IF usage was reported in scientific literature.

Reactivity Notes

Rabbit reactivity reported from customer review.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB27B Antibody

• C25KG
• RAB27B, member RAS oncogene family
• ras-related protein Rab-27B

Background

RAB27B may be involved in targeting uroplakins to urothelial apical membranes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB27B Antibody (H00005874-B01P)(2)

Publications using H00005874-B01P

• Chiang L, Karvar S, Hamm-Alvarez SF. Direct Imaging of RAB27B-Enriched Secretory Vesicle Biogenesis in Lacrimal Acinar Cells Reveals Origins on a Nascent Vesicle Budding Site. PLoS One;7(2):e31789. 2012-01-01 [PMID: 22363735]
• Chiang L, Ngo J, Schechter J et al. Rab27b regulates exocytosis of secretory vesicles in acinar epithelial cells from the lacrimal gland Am J Physiol Cell Physiol 2011-08-01 [PMID: 21525430] (ICC/IF, WB, Rabbit)

Reviews for RAB27B Antibody (H00005874-B01P) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Other.

reviewed by: System Admin ICC Other 05/27/2009

Summary

• Application: Immunocytochemistry
• Sample Tested: Rabbit LG
• Species: Other

reviewed by: System Admin WB Other 05/27/2009

Summary

• Application: Western Blot
• Sample Tested: Rabbit LG Tissue
• Species: Other
• Lot: 08249WULz

Bioinformatics

• Gene Symbol: RAB27B
• Entrez:
  • 5874(Human)
• Uniprot:
  • AAH27474(Human)