Recombinant Human RAB26 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB26 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 157-254 of Human RAB26 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB26

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB26 Protein

  • RAB26, member RAS oncogene family
  • Ras-related oncogene protein
  • ras-related protein Rab-26
  • V46133

Background

RAB26 - RAB26, member RAS oncogene family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6270
Species: Hu
Applications: ICC
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP2-45926
Species: Hu, Mk
Applications: WB, IHC, IHC-P, IF
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-00574
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NBP2-22478
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00025837-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB26 Partial Recombinant Protein (H00025837-Q01) (0)

There are no publications for RAB26 Partial Recombinant Protein (H00025837-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB26 Partial Recombinant Protein (H00025837-Q01) (0)

There are no reviews for RAB26 Partial Recombinant Protein (H00025837-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB26 Partial Recombinant Protein (H00025837-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB26 Products

Bioinformatics Tool for RAB26 Partial Recombinant Protein (H00025837-Q01)

Discover related pathways, diseases and genes to RAB26 Partial Recombinant Protein (H00025837-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB26 Partial Recombinant Protein (H00025837-Q01)

Discover more about diseases related to RAB26 Partial Recombinant Protein (H00025837-Q01).
 

Pathways for RAB26 Partial Recombinant Protein (H00025837-Q01)

View related products by pathway.

PTMs for RAB26 Partial Recombinant Protein (H00025837-Q01)

Learn more about PTMs related to RAB26 Partial Recombinant Protein (H00025837-Q01).
 

Research Areas for RAB26 Partial Recombinant Protein (H00025837-Q01)

Find related products by research area.

Blogs on RAB26.

ATG5 - an essential regulator of autophagosome assembly
Autophagy is important for the removal of damaged organelles or proteins as well as for the regulation of cellular homeostasis in response to stress. Proteins or organelles that are targeted for degradation are engulfed in a double-membrane structu...  Read full blog post.

Customers Who Bought This Also Bought

RAB26 Antibody
NBP1-58882
Rab27a Antibody (1G7)
H00005873-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB26 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB26