RAB10 Antibody

Images

 
Western Blot: RAB10 Antibody [NBP1-92307] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RAB10 Antibody [NBP1-92307] - Staining of human esophagus shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Western Blot: RAB10 Antibody [NBP1-92307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RAB10 Antibody [NBP1-92307] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: RAB10 Antibody [NBP1-92307] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RAB10 Antibody [NBP1-92307] - Staining of human skin shows moderate to strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC
Specificity
Specificity of human, rat RAB10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB10 Antibody

  • GTP-binding protein RAB10
  • RAB10, member RAS oncogene family
  • ras-related GTP-binding protein
  • ras-related protein Rab-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-57094
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-55113
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-79962
Species: Hu, Mu, Rt, Po, Bv, Ca, Gt, Mk, Ze
Applications: WB, IHC
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45499
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu, Bv, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NB100-74519
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-85799
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAB10 Antibody (NBP1-92307) (0)

There are no publications for RAB10 Antibody (NBP1-92307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB10 Antibody (NBP1-92307) (0)

There are no reviews for RAB10 Antibody (NBP1-92307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB10 Antibody (NBP1-92307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB10 Products

Bioinformatics Tool for RAB10 Antibody (NBP1-92307)

Discover related pathways, diseases and genes to RAB10 Antibody (NBP1-92307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB10 Antibody (NBP1-92307)

Discover more about diseases related to RAB10 Antibody (NBP1-92307).
 

Pathways for RAB10 Antibody (NBP1-92307)

View related products by pathway.

PTMs for RAB10 Antibody (NBP1-92307)

Learn more about PTMs related to RAB10 Antibody (NBP1-92307).
 

Research Areas for RAB10 Antibody (NBP1-92307)

Find related products by research area.

Blogs on RAB10

There are no specific blogs for RAB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB10