RAB10 Antibody

Product Discontinued

RAB10 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAB10 Antibody

• GTP-binding protein RAB10
• RAB10, member RAS oncogene family
• ras-related GTP-binding protein
• ras-related protein Rab-10

Background

RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 (PubMed 9918381)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB10