QRICH1 Antibody

Images

 
Western Blot: QRICH1 Antibody [NBP2-32693] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: QRICH1 Antibody [NBP2-32693] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: QRICH1 Antibody [NBP2-32693] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QRICH1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QRICH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
QRICH1 Protein (NBP2-32693PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for QRICH1 Antibody

  • FLJ20259
  • glutamine-rich 1
  • glutamine-rich protein 1
  • MGC131838

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13550
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-458
Species: Hu
Applications: WB, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-04656
Species: Hu
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-76523
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
NBP1-81929
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80053
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13551
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32693
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for QRICH1 Antibody (NBP2-32693) (0)

There are no publications for QRICH1 Antibody (NBP2-32693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QRICH1 Antibody (NBP2-32693) (0)

There are no reviews for QRICH1 Antibody (NBP2-32693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for QRICH1 Antibody (NBP2-32693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional QRICH1 Products

Bioinformatics Tool for QRICH1 Antibody (NBP2-32693)

Discover related pathways, diseases and genes to QRICH1 Antibody (NBP2-32693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for QRICH1 Antibody (NBP2-32693)

View related products by pathway.

Research Areas for QRICH1 Antibody (NBP2-32693)

Find related products by research area.

Blogs on QRICH1

There are no specific blogs for QRICH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QRICH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QRICH1