KIAA1958 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA1958 Antibody [NBP1-81929] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: KIAA1958 Antibody [NBP1-81929] - Staining in human kidney and placenta tissues using anti-KIAA1958 antibody. Corresponding KIAA1958 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: KIAA1958 Antibody [NBP1-81929] - Staining of human kidney shows strong cytoplasmic positivity tubule cells.
Immunohistochemistry-Paraffin: KIAA1958 Antibody [NBP1-81929] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: KIAA1958 Antibody [NBP1-81929] - Staining of human placenta shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KIAA1958 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTATCRAGSQERVCFQDNRSFNSDSPSIIGVPSETQTSPVERYPGRPVKAKLDCNRTRDSCDFSYCSEP
Specificity
Specificity of human KIAA1958 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1958
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1958 Antibody

  • FLJ39294
  • hypothetical protein LOC158405
  • KIAA1958
  • MGC142075

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82196
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-13550
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-458
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-04656
Species: Hu
NBP2-75630
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76523
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-80053
Species: Hu, Ca, Eq, Rb
Applications: WB, IHC, IHC-P
NBP2-13551
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81929
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KIAA1958 Antibody (NBP1-81929) (0)

There are no publications for KIAA1958 Antibody (NBP1-81929).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1958 Antibody (NBP1-81929) (0)

There are no reviews for KIAA1958 Antibody (NBP1-81929). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1958 Antibody (NBP1-81929) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIAA1958 Products

Bioinformatics Tool for KIAA1958 Antibody (NBP1-81929)

Discover related pathways, diseases and genes to KIAA1958 Antibody (NBP1-81929). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for KIAA1958 Antibody (NBP1-81929)

View related products by pathway.

Blogs on KIAA1958

There are no specific blogs for KIAA1958, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1958 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1958