Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Novus Biologicals Rabbit Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody - BSA Free (NBP1-85955) is a polyclonal antibody validated for use in IHC and WB. Anti-Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Western Blot Reported in scientifc literature (PMID: 30092282)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Pyruvate dehydrogenase kinase isoform 1 (PDK1) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhbits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. PDK1 antibodies are useful tools for glucose metabolism research and mitochondrial metabolism studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (NBP1-85955) (0)
There are no reviews for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (NBP1-85955).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody - BSA Free and receive a gift card or discount.