Recombinant Human PXMP3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PXMP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-305 of Human PXMP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNIREVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PEX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
61.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXMP3 Protein

  • PAF-1
  • PAF1peroxisomal membrane protein 3 (35kD, Zellweger syndrome)
  • Peroxin-2
  • peroxisomal biogenesis factor 2,35 kDa peroxisomal membrane protein
  • Peroxisomal membrane protein 3
  • peroxisomal membrane protein 3, 35kDa
  • Peroxisome assembly factor 1
  • peroxisome biogenesis factor 2
  • PMP35PMP3
  • PXMP3peroxisome assembly factor-1
  • RNF72RING finger protein 72
  • ZWS3

Background

This gene encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-61052
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-65021
Species: Hu
NBP1-87185
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-54770
Species: Hu, Y, Ye
Applications: WB, ChIP, ELISA, ICC/IF, ChIP
NBP2-49599
Species: Hu
Applications: WB, IHC, IHC-P
8090-ZN
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89423
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-80577
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
H00005828-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PXMP3 Recombinant Protein (H00005828-P01) (0)

There are no publications for PXMP3 Recombinant Protein (H00005828-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXMP3 Recombinant Protein (H00005828-P01) (0)

There are no reviews for PXMP3 Recombinant Protein (H00005828-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXMP3 Recombinant Protein (H00005828-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PXMP3 Products

Bioinformatics Tool for PXMP3 Recombinant Protein (H00005828-P01)

Discover related pathways, diseases and genes to PXMP3 Recombinant Protein (H00005828-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXMP3 Recombinant Protein (H00005828-P01)

Discover more about diseases related to PXMP3 Recombinant Protein (H00005828-P01).
 

Pathways for PXMP3 Recombinant Protein (H00005828-P01)

View related products by pathway.

PTMs for PXMP3 Recombinant Protein (H00005828-P01)

Learn more about PTMs related to PXMP3 Recombinant Protein (H00005828-P01).
 

Research Areas for PXMP3 Recombinant Protein (H00005828-P01)

Find related products by research area.

Blogs on PXMP3

There are no specific blogs for PXMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PXMP3 Antibody
NBP1-87351

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXMP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX2