We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PXMP3 Recombinant Protein Antigen

Images

 
There are currently no images for PXMP3 Protein (NBP1-87352PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PXMP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX2.

Source: E. coli

Amino Acid Sequence: NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87352.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PXMP3 Recombinant Protein Antigen

  • PAF-1
  • PAF1peroxisomal membrane protein 3 (35kD, Zellweger syndrome)
  • Peroxin-2
  • peroxisomal biogenesis factor 2,35 kDa peroxisomal membrane protein
  • Peroxisomal membrane protein 3
  • peroxisomal membrane protein 3, 35kDa
  • Peroxisome assembly factor 1
  • peroxisome biogenesis factor 2
  • PMP35PMP3
  • PXMP3peroxisome assembly factor-1
  • RNF72RING finger protein 72
  • ZWS3

Background

PXMP3 encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-184
Species: Hu, Mu
Applications: IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB100-61052
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-57578
Species: Hu
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87258
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-68205
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-42854
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49599
Species: Hu
Applications: IHC,  IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-16704
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB100-2242
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80967
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NB100-558
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB

Publications for PXMP3 Protein (NBP1-87352PEP) (0)

There are no publications for PXMP3 Protein (NBP1-87352PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXMP3 Protein (NBP1-87352PEP) (0)

There are no reviews for PXMP3 Protein (NBP1-87352PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PXMP3 Protein (NBP1-87352PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PXMP3 Products

Research Areas for PXMP3 Protein (NBP1-87352PEP)

Find related products by research area.

Blogs on PXMP3

There are no specific blogs for PXMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PXMP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX2