PURA Antibody (3A9)

Images

 
Western Blot: PURA Antibody (3A9) [H00005813-M05] - Analysis of PURA expression in PC-12 (Cat # L012V1).
Sandwich ELISA: PURA Antibody (3A9) [H00005813-M05] - Detection limit for recombinant GST tagged PURA is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
3A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PURA Antibody (3A9) Summary

Immunogen
PURA (NP_005850 183 a.a. - 292 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC
Specificity
PURA - purine-rich element binding protein A (3A9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PURA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PURA Antibody (3A9)

  • PUR1PUR-ALPHA
  • PURALPHA
  • purine-rich element binding protein A
  • Purine-rich single-stranded DNA-binding protein alpha
  • transcriptional activator protein Pur-alpha

Background

This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-70691
Species: Hu
Applications: WB
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
H00005813-M05
Species: Hu, Rt
Applications: WB, ELISA

Publications for PURA Antibody (H00005813-M05) (0)

There are no publications for PURA Antibody (H00005813-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PURA Antibody (H00005813-M05) (0)

There are no reviews for PURA Antibody (H00005813-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PURA Antibody (H00005813-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PURA Antibody (H00005813-M05)

Discover related pathways, diseases and genes to PURA Antibody (H00005813-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PURA Antibody (H00005813-M05)

Discover more about diseases related to PURA Antibody (H00005813-M05).
 

Pathways for PURA Antibody (H00005813-M05)

View related products by pathway.

PTMs for PURA Antibody (H00005813-M05)

Learn more about PTMs related to PURA Antibody (H00005813-M05).
 

Research Areas for PURA Antibody (H00005813-M05)

Find related products by research area.

Blogs on PURA

There are no specific blogs for PURA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PURA Antibody (3A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PURA
Entrez
Uniprot