We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTTG1IP Recombinant Protein Antigen

Images

 
There are currently no images for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTTG1IP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTTG1IP.

Source: E. coli

Amino Acid Sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTTG1IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57370.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTTG1IP Recombinant Protein Antigen

  • C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein
  • PBFPTTG-binding factor
  • pituitary tumor-transforming 1 interacting protein
  • Pituitary tumor-transforming gene protein-binding factor

Background

PTTG1IP, also known as Pituitary tumor-transforming gene 1 protein-interacting protein, is a 180 amino-acid protein that is 20 kDa, and may facilitate PTTG1 nuclear translocation and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. Disease research is currently being performed with relation to this protein and pituitary tumor intrahepatic cholangiocarcinoma, pituitary adenoma, cholangiocarcinoma, adenoma astrocytoma, breast cancer, and thyroiditis. PTTG1IP protein involvement has been observed with relation to PTTG1, UBC and RAB4A in protein import into nucleus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20287
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
233-FB
Species: Hu
Applications: BA
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP3-17459
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-57370PEP
Species: Hu
Applications: AC

Publications for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP) (0)

There are no publications for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP) (0)

There are no reviews for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTTG1IP Recombinant Protein Antigen (NBP2-57370PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTTG1IP Products

Blogs on PTTG1IP

There are no specific blogs for PTTG1IP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTTG1IP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTTG1IP