Recombinant Human PTPN12 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PTPN12 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 682-779 of Human PTPN12

Source: Wheat Germ

Amino Acid Sequence: PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PTPN12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTPN12 Protein

  • protein tyrosine phosphatase, non-receptor type 12
  • Protein-tyrosine phosphatase G1
  • PTPG1tyrosine-protein phosphatase non-receptor type 12
  • PTP-PESTEC 3.1.3.48

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a C-terminal PEST motif, which serves as a protein-protein interaction domain, and may regulate protein intracellular half-life. This PTP was found to bind and dephosphorylate the product of the oncogene c-ABL and thus may play a role in oncogenesis. This PTP was also shown to interact with, and dephosphorylate, various products related to cytoskeletal structure and cell adhesion, such as p130 (Cas), CAKbeta/PTK2B, PSTPIP1, and paxillin. This suggests it has a regulatory role in controlling cell shape and mobility. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85764
Species: Hu
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
AF3428
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-07463
Species: Hu
H00005782-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no publications for PTPN12 Partial Recombinant Protein (H00005782-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no reviews for PTPN12 Partial Recombinant Protein (H00005782-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Discover related pathways, diseases and genes to PTPN12 Partial Recombinant Protein (H00005782-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Discover more about diseases related to PTPN12 Partial Recombinant Protein (H00005782-Q01).
 

Pathways for PTPN12 Partial Recombinant Protein (H00005782-Q01)

View related products by pathway.

PTMs for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Learn more about PTMs related to PTPN12 Partial Recombinant Protein (H00005782-Q01).

Blogs on PTPN12

There are no specific blogs for PTPN12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PTPN12 Antibody
NBP1-87188

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTPN12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN12