PTPN12 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

PTPN12 Partial Recombinant Protein Summary

Description
PTPN12 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
PTPN12

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTPN12 Partial Recombinant Protein

  • protein tyrosine phosphatase, non-receptor type 12
  • Protein-tyrosine phosphatase G1
  • PTPG1tyrosine-protein phosphatase non-receptor type 12
  • PTP-PESTEC 3.1.3.48

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a C-terminal PEST motif, which serves as a protein-protein interaction domain, and may regulate protein intracellular half-life. This PTP was found to bind and dephosphorylate the product of the oncogene c-ABL and thus may play a role in oncogenesis. This PTP was also shown to interact with, and dephosphorylate, various products related to cytoskeletal structure and cell adhesion, such as p130 (Cas), CAKbeta/PTK2B, PSTPIP1, and paxillin. This suggests it has a regulatory role in controlling cell shape and mobility. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60837
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2685
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-85764
Species: Hu
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-38206
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45646
Species: Hu, Ca
Applications: WB, IHC
NB100-2307
Species: Hu
Applications: WB
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00007837-M03
Species: Hu
Applications: WB, ELISA
H00005782-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no publications for PTPN12 Partial Recombinant Protein (H00005782-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no reviews for PTPN12 Partial Recombinant Protein (H00005782-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPN12 Partial Recombinant Protein (H00005782-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTPN12 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Discover related pathways, diseases and genes to PTPN12 Partial Recombinant Protein (H00005782-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Discover more about diseases related to PTPN12 Partial Recombinant Protein (H00005782-Q01).
 

Pathways for PTPN12 Partial Recombinant Protein (H00005782-Q01)

View related products by pathway.

PTMs for PTPN12 Partial Recombinant Protein (H00005782-Q01)

Learn more about PTMs related to PTPN12 Partial Recombinant Protein (H00005782-Q01).

Blogs on PTPN12

There are no specific blogs for PTPN12, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PTPN12

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00005782-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

PTPN12 Recombinant Protein
H00005782-P01-10ug
PTPN12 Antibody
NBP1-87188
PTPN12 Antibody
NBP1-87188
PTPN12 Antibody
NBP1-87188