PSMD14 Antibody (4A10-E8) - Azide and BSA Free

Western Blot: PSMD14 Antibody (4A10-E8) [H00010213-M01] - PSMD14 monoclonal antibody (M01), clone 4A10-E8 Analysis of PSMD14 expression in A-431.

Immunocytochemistry/Immunofluorescence: PSMD14 Antibody (4A10-E8) [H00010213-M01] - Analysis of monoclonal antibody to PSMD14 on A-431 cell. Antibody concentration 25 ug/ml.

Sandwich ELISA: PSMD14 Antibody (4A10-E8) [H00010213-M01] - Detection limit for recombinant GST tagged PSMD14 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4A10-E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PSMD14 Antibody (4A10-E8) - Azide and BSA Free Summary

• Immunogen: PSMD14 (AAH09524.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
• Localization: Cytoplasmic and Nuclear
• Specificity: PSMD14 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PSMD14
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMD14 Antibody (4A10-E8) - Azide and BSA Free

• EC 3.1.2.15
• EC 3.4.19.-
• pad1
• POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11
• proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Rpn11
• RPN11,26S proteasome-associated PAD1 homolog 1

Background

PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMD14
• Entrez:
  • 10213(Human)
• OMIM:
  • 607173(Human)
• Uniprot:
  • AAH09524(Human)