Recombinant Human PSMC3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PSMC3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 53-152 of Human PSMC3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PSMC3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PSMC3 Protein

  • human immunodeficiency virus tat transactivator binding protein-1
  • MGC8487
  • proteasome (prosome, macropain) 26S subunit, ATPase, 3,26S proteasome AAA-ATPase subunit RPT5
  • Proteasome 26S subunit ATPase 3
  • Proteasome subunit P50
  • TBP-126S protease regulatory subunit 6A
  • TBP1Tat-binding protein 1

Background

PSMC3 - proteasome (prosome, macropain) 26S subunit, ATPase, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49218
Species: Hu
Applications: IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91974
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92301
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005702-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PSMC3 Partial Recombinant Protein (H00005702-Q01) (0)

There are no publications for PSMC3 Partial Recombinant Protein (H00005702-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMC3 Partial Recombinant Protein (H00005702-Q01) (0)

There are no reviews for PSMC3 Partial Recombinant Protein (H00005702-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMC3 Partial Recombinant Protein (H00005702-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PSMC3 Products

Bioinformatics Tool for PSMC3 Partial Recombinant Protein (H00005702-Q01)

Discover related pathways, diseases and genes to PSMC3 Partial Recombinant Protein (H00005702-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMC3 Partial Recombinant Protein (H00005702-Q01)

Discover more about diseases related to PSMC3 Partial Recombinant Protein (H00005702-Q01).
 

Pathways for PSMC3 Partial Recombinant Protein (H00005702-Q01)

View related products by pathway.

PTMs for PSMC3 Partial Recombinant Protein (H00005702-Q01)

Learn more about PTMs related to PSMC3 Partial Recombinant Protein (H00005702-Q01).

Blogs on PSMC3

There are no specific blogs for PSMC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PSMC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC3