PSMB5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PSMB5 Antibody [NBP2-57323] - Staining of human cell line U-2 OS shows localization to nucleus & centrosome. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSMB5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMB5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PSMB5 Recombinant Protein Antigen (NBP2-57323PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSMB5 Antibody - BSA Free

• LMPX
• LMPXproteasome beta 5 subunit
• Macropain epsilon chain
• MB1
• MB1EC 3.4.25.1
• Multicatalytic endopeptidase complex epsilon chain
• proteasome (prosome, macropain) subunit, beta type, 5
• proteasome catalytic subunit 3
• Proteasome chain 6
• Proteasome epsilon chain
• proteasome subunit beta type-5
• Proteasome subunit MB1
• Proteasome subunit X
• proteasome subunit, beta type, 5
• PSMB5
• PSX large multifunctional protease X
• XMGC104214

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB5