PSG9 Antibody - BSA Free

Western Blot: PSG9 Antibody [NBP1-57676] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSG9 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSG9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSG9 Antibody - BSA Free

• pregnancy specific beta-1-glycoprotein 9
• Pregnancy-specific beta-1 glycoprotein B
• Pregnancy-specific beta-1-glycoprotein 11
• pregnancy-specific beta-1-glycoprotein 9
• Pregnancy-specific glycoprotein 11
• Pregnancy-specific glycoprotein 7
• Pregnancy-specific glycoprotein 9
• PS34
• PS-beta-B
• PS-beta-G-11
• PS-beta-G-9
• PSBG-11
• PSBG-9
• PSG11pregnancy specific beta-1-glycoprotein 11
• PSG7
• PSGII

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSG9
• Uniprot:
  • Q00887(Human)