PSG9 Antibody [Biotin]

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Biotin

PSG9 Antibody [Biotin] Summary

• Immunogen: Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSG9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PSG9 Antibody [Biotin]

• pregnancy specific beta-1-glycoprotein 9
• Pregnancy-specific beta-1 glycoprotein B
• Pregnancy-specific beta-1-glycoprotein 11
• pregnancy-specific beta-1-glycoprotein 9
• Pregnancy-specific glycoprotein 11
• Pregnancy-specific glycoprotein 7
• Pregnancy-specific glycoprotein 9
• PS34
• PS-beta-B
• PS-beta-G-11
• PS-beta-G-9
• PSBG-11
• PSBG-9
• PSG11pregnancy specific beta-1-glycoprotein 11
• PSG7
• PSGII

Background

The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSG9