Protein phosphatase 1 inhibitor 3D Recombinant Protein Antigen

Images

 
There are currently no images for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Protein phosphatase 1 inhibitor 3D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R3D.

Source: E. coli

Amino Acid Sequence: ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R3D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87235.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Protein phosphatase 1 inhibitor 3D Recombinant Protein Antigen

  • DKFZp781L2441
  • PP1 subunit R6
  • PPP1R6
  • protein phosphatase 1 regulatory subunit 3D
  • protein phosphatase 1 regulatory subunit 6
  • protein phosphatase 1, regulatory subunit 3D
  • protein phosphatase 1, regulatory subunit 6, spinophilin
  • protein phosphatase 1-binding subunit R6
  • regulatory (inhibitor) subunit 3D

Background

Phosphorylation of serine and threonine residues in proteins is a crucial step in the regulation of many cellular functions ranging from hormonal regulation to cell division and even short-term memory. The level of phosphorylation is controlled by the opposing actions of protein kinases and protein phosphatases. Protein phosphatase 1 (PP1) is 1 of 4 major serine/threonine-specific protein phosphatases which have been identified in eukaryotic cells. PP1 associates with various regulatory subunits that dictate its subcellular localization and modulate its substrate specificity. Several subunits that target PP1 to glycogen have been identified. This gene encodes a glycogen-targeting subunit of PP1. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87236
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82243
Species: Hu
Applications: IHC,  IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16471
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-17131
Species: Hu
Applications: IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-32618
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-97766
Species: Hu
Applications: PEP-ELISA, WB
NBP2-24490
Species: Ca, Eq, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP1-31365
Species: Ch, Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, WB
NBP2-31715
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34170
Species: Hu
Applications: IHC,  IHC-P
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-91191
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38367
Species: Hu
Applications: ICC/IF

Publications for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP) (0)

There are no publications for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP) (0)

There are no reviews for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein phosphatase 1 inhibitor 3D Products

Blogs on Protein phosphatase 1 inhibitor 3D

There are no specific blogs for Protein phosphatase 1 inhibitor 3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Protein phosphatase 1 inhibitor 3D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R3D