Home » Proteasome 20S beta 3 » Proteasome 20S beta 3 Proteins » Proteasome 20S beta 3 Recombinant Protein Antigen

Proteasome 20S beta 3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Proteasome 20S beta 3 Protein (NBP2-33380PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Proteasome 20S beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB3.

Source: E.coli

Amino Acid Sequence: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33380.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Proteasome 20S beta 3 Recombinant Protein Antigen

  • EC 3.4.25.1
  • HC10-II
  • MGC4147
  • proteasome (prosome, macropain) subunit, beta type, 3
  • Proteasome chain 13
  • Proteasome component C10-II
  • proteasome subunit beta type-3
  • Proteasome theta chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LMP7/PSMB8
Antibody (JB54-32)
NBP2-75554
Western Blot: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Analysis of Proteasome 20S LMP7 on U937 (1) and A431 (2) cell lysate using anti-Proteasome 20S LMP7 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Staining Proteasome 20S LMP7 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody (JB54-32) [NBP2-75554] - Analysis of paraffin-embedded rat epididymis tissue using anti-Proteasome 20S LMP7 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
LMP2/PSMB9
Antibody (OTI1D1)
NBP2-01817
Western Blot: LMP2/PSMB9 Antibody (OTI1D1) [NBP2-01817] - Analysis of extracts (10ug) from Jurkat cell line by using anti-PSMB9 monoclonal antibody (1:200).
Immunocytochemistry/Immunofluorescence: LMP2/PSMB9 Antibody (OTI1D1) [NBP2-01817] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Proteasome 20S LMP2.
Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody (1D1) [NBP2-01817] - Human tonsil.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PSMB5 Antibody
NBP2-19983
Western Blot: PSMB5 Antibody [NBP2-19983] - Sample (30 ug of whole cell lysate) A: A431 B: H1299 12% SDS PAGE diluted at 1:1000
Immunocytochemistry/Immunofluorescence: PSMB5 Antibody [NBP2-19983] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSMB5 Antibody [NBP2-19983] - Immunohistochemical analysis of paraffin-embedded OVCAR3 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Proteasome 20S
beta2 Antibody
NBP1-92294
Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Proteasome 20S
alpha 5 Antibody
NBP1-32387
Western Blot: Proteasome 20S alpha 5 Antibody [NBP1-32387] - Proteasome 20S alpha 5 antibody detects Proteasome 20S alpha 5 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Proteasome 20S alpha 5 antibody diluted by 1:1000.
Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 5 Antibody [NBP1-32387] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Proteasome 20S alpha 5 Antibody [NBP1-32387] - Proteasome 20S alpha 5 antibody detects Proteasome 20S alpha 5 protein at cytoplasm and nucleus in human hepatocellular carcinoma by immunohistochemical analysis. Sample: Paraffin-embedded human hepatocellular carcinoma. Proteasome 20S alpha 5 antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Aldo-keto
Reductase 1C1/AKR1C1 ...
MAB6529
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and human liver tissue. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Aldo‑keto Reductase 1C1/AKR1C1 Monoclonal Antibody (Catalog # MAB6529) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Aldo‑keto Reductase 1C1/AKR1C1 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line and human liver tissue, loaded at 0.5 mg/mL. A specific band was detected for Aldo‑keto Reductase 1C1/AKR1C1 at approximately 41 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Aldo‑keto Reductase 1C1/AKR1C1 Monoclonal Antibody (Catalog # MAB6529). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu
Applications: WB, Simple Western
PSMB10/MECL1
Antibody
NBP1-88660
Western Blot: PSMB10/MECL1 Antibody [NBP1-88660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-450
Immunocytochemistry/Immunofluorescence: PSMB10/MECL1 Antibody [NBP1-88660] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP1-88660] - Staining in human lymph node and cerebral cortex tissues using anti-PSMB10 antibody. Corresponding PSMB10 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PA28 Activator
alpha Subunit/PSME1 A ...
NBP2-75606
Western Blot: PA28 Activator alpha Subunit/PSME1 Antibody (JU60-33) [NBP2-75606] - Analysis of PSME1 on MCF-7 cell (1) and rat lung tissue (2) lysate using anti-PSME1 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: PA28 Activator alpha Subunit/PSME1 Antibody (JU60-33) [NBP2-75606] - Staining PSME1 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PA28 Activator alpha Subunit/PSME1 Antibody (JU60-33) [NBP2-75606] - Analysis of paraffin-embedded rat kidney tissue using anti-PSME1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
STARD3 Antibody
NBP2-94159
Western Blot: STARD3 Antibody [NBP2-94159] - Analysis of extracts of various cell lines, using STARD3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 15s.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Nbs1 Antibody
NB100-143
Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Nbs1 Antibody [NB100-143] - Western Blot with Nbs1 Antibody [NB100-143]. KSHV LANA recruits MRN (Mre11-Rad50-NBS1) complex. Co-immunoprecipitation of endogenous LANA and MRN proteins in BC3 cells. Cells were lysed using TBS-T buffer and the cell lysate was incubated with benzonase. After centrifugation, supernatant was incubated overnight with anti-LANA or IgG-control beads. The precipitated complexes were analyzed for the presence of endogenous Rad50, Mre11 and NBS1 by SDS-PAGE and immunoblotting. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.ppat.1006335), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Nbs1 Antibody [NB100-143] - ICC/IF analysis of Nbs1 in HeLa cells with Nbs1 Antibody [NB100-143]. Image from verified customer review.
(8 Reviews)
(178 Publications)
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
PNMT Antibody
(OTI1D2)
NBP2-00688
Western Blot: PNMT Antibody (OTI1D2) [NBP2-00688] - Analysis of extracts (10ug) from 9 Human tissue by using anti-PNMT monoclonal antibody at 1:200 (1: Testis; 2: Omentum; 3: Uterus; 4: Breast; 5: Brain; 6: Liver; 7: Ovary; 8: Thyroid gland; 9: colon).
Immunocytochemistry/Immunofluorescence: PNMT Antibody (1D2) [NBP2-00688] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PNMT.
Immunohistochemistry-Paraffin: PNMT Antibody (1D2) [NBP2-00688] - Staining of paraffin-embedded Human endometrium tissue using anti-PNMT mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Tnk1 Antibody
NBP2-85965
Western Blot: Tnk1 Antibody [NBP2-85965] - Host: Rabbit. Target Name: TNK1. Antibody Dilution: 1.0ug/ml. Sample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226
Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP2-85965] - Rabbit Anti-TNK1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Species: Hu
Applications: WB, IHC, IHC-P
PSMB7 Antibody
(OTI1E1)
NBP2-01832
Western Blot: PSMB7 Antibody (OTI1E1) [NBP2-01832] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 20S beta 7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 20S beta 7.
Immunohistochemistry-Paraffin: PSMB7 Antibody (OTI1E1) [NBP2-01832] - Staining of paraffin-embedded Human prostate tissue using anti-Proteasome 20S beta 7 mouse monoclonal antibody.
Western Blot: PSMB7 Antibody (OTI1E1) [NBP2-01832] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 20S beta 7 monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(41 Publications)
Species: Hu
Applications: WB, IHC, IP
Proteasome 20S
alpha 6 Antibody (OTI ...
NBP2-03836
Western Blot: Proteasome 20S alpha 6 Antibody (4C9) [NBP2-03836] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-Proteasome 20S alpha 6 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry-Paraffin: Proteasome 20S alpha 6 Antibody (4C9) [NBP2-03836] - Staining of paraffin-embedded Human pancreas tissue using anti-Proteasome 20S alpha 6 mouse monoclonal antibody.
Flow Cytometry: Proteasome 20S alpha 6 Antibody (4C9) [NBP2-03836] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Proteasome 20S alpha 6 antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Rev-erb A
alpha/NR1D1 Antibody
H00009572-M02
Western Blot: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - NR1D1 monoclonal antibody (M02), clone 4F6. Analysis of NR1D1 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - Analysis of monoclonal antibody to NR1D1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - Representative tissue microarray specimens stained for NR1D1. Immunoreactivity of representative tumor specimens is shown. Low and high NR1D1 expression groups are defined in methods. The low NR1D1 expression ranges from immunoreactive scores 2 to 6 (left (P2xI1), middle (P3xI1), and right (P3xI2)), and the high NR1D1 expression shows immunoreactive score 12 (all, P4xI3). Image collected and cropped by CiteAb from the following publication (https://breast-cancer-research.biomedcentral.com/articles/10.1186/s13058-019-1197-x) licensed under a CC-BY licence.
(4 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Proteasome 20S
alpha 3 Antibody (JE5 ...
NBP2-80474
Western Blot: Proteasome 20S alpha 3 Antibody (JE51-59) [NBP2-80474] - Analysis of Proteasome 20S alpha 3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (NBP2-80474, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: A549 cell lysateLane 2: PC-12 cell lysateLane 3: NIH/3T3 cell lysate
Immunocytochemistry/Immunofluorescence: Proteasome 20S alpha 3 Antibody (JE51-59) [NBP2-80474] - Staining of PSMA3 in SW620 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the primary antibody (ET7110-20, 1/50) for 1 hour at room temperature, washed with PBS. Alexa Fluor488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/1,000 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: Proteasome 20S alpha 3 Antibody (JE51-59) [NBP2-80474] - Analysis in human placenta tissue using Proteasome 20S alpha 3 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temper
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PSMA4 Antibody
(OTI4B8)
NBP2-01608
Western Blot: PSMA4 Antibody (4B8) [NBP2-01608] Analysis of extracts (35ug) from 9 different cell lines by using anti-PSMA4 monoclonal antibody.
Immunohistochemistry-Paraffin: PSMA4 Antibody (4B8) [NBP2-01608] - Staining of paraffin-embedded Human prostate tissue using anti-PSMA4 mouse monoclonal antibody.
Western Blot: PSMA4 Antibody (4B8) [NBP2-01608] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PSMA4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PSMA4.
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P

Publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Proteasome 20S beta 3 Products

Bioinformatics Tool for Proteasome 20S beta 3 Protein (NBP2-33380PEP)

Discover related pathways, diseases and genes to Proteasome 20S beta 3 Protein (NBP2-33380PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S beta 3 Protein (NBP2-33380PEP)

Discover more about diseases related to Proteasome 20S beta 3 Protein (NBP2-33380PEP).
 

Pathways for Proteasome 20S beta 3 Protein (NBP2-33380PEP)

View related products by pathway.

PTMs for Proteasome 20S beta 3 Protein (NBP2-33380PEP)

Learn more about PTMs related to Proteasome 20S beta 3 Protein (NBP2-33380PEP).

Blogs on Proteasome 20S beta 3

There are no specific blogs for Proteasome 20S beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome 20S beta 3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PSMB3