Proteasome 20S beta 3 Recombinant Protein Antigen

Images

 
There are currently no images for Proteasome 20S beta 3 Protein (NBP2-33380PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Proteasome 20S beta 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB3.

Source: E. coli

Amino Acid Sequence: LYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33380. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome 20S beta 3 Recombinant Protein Antigen

  • EC 3.4.25.1
  • HC10-II
  • MGC4147
  • proteasome (prosome, macropain) subunit, beta type, 3
  • Proteasome 20S beta 3
  • Proteasome chain 13
  • Proteasome component C10-II
  • proteasome subunit beta type-3
  • Proteasome theta chain
  • PSMB3

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83121
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP3-17314
Species: Hu
Applications: ICC/IF, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86477
Species: Hu
Applications: IHC,  IHC-P
NBP2-01832
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-03836
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-92293
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB

Publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no publications for Proteasome 20S beta 3 Protein (NBP2-33380PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no reviews for Proteasome 20S beta 3 Protein (NBP2-33380PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome 20S beta 3 Protein (NBP2-33380PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome 20S beta 3 Products

Blogs on Proteasome 20S beta 3

There are no specific blogs for Proteasome 20S beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome 20S beta 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB3