Proprotein Convertase 2/PCSK2 Antibody

Images

 
Western Blot: Proprotein Convertase 2 Antibody [NBP1-69146] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proprotein Convertase 2/PCSK2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCSK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCSK2 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Proprotein Convertase 2/PCSK2 Antibody

  • EC 3.4.21
  • EC 3.4.21.94
  • KEX2-like endoprotease 2
  • NEC 2
  • NEC2
  • NEC2SPC2
  • neuroendocrine convertase 2
  • PC2
  • PC2NEC-2
  • PCSK2
  • Prohormone convertase 2
  • Proprotein Convertase 2
  • proprotein convertase subtilisin/kexin type 2
  • SPC2

Background

This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in hormone biosynthesis by processing a variety of prohormones including proinsulin, proopiomelanocortin and proluteinizing-hormone-releasing hormone. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
2984-SE
Species: Hu

Publications for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146) (0)

There are no publications for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146) (0)

There are no reviews for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proprotein Convertase 2/PCSK2 Products

Bioinformatics Tool for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146)

Discover related pathways, diseases and genes to Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146)

Discover more about diseases related to Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146).
 

Pathways for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146)

View related products by pathway.

PTMs for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146)

Learn more about PTMs related to Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146).
 

Research Areas for Proprotein Convertase 2/PCSK2 Antibody (NBP1-69146)

Find related products by research area.

Blogs on Proprotein Convertase 2/PCSK2

There are no specific blogs for Proprotein Convertase 2/PCSK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proprotein Convertase 2/PCSK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK2
Entrez