Proapoptotic Caspase Adaptor Protein Antibody


Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining in human lymph node and placenta tissues using anti-MZB1 antibody. Corresponding MZB1 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Immunohistochemical staining of human tonsil shows cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP2-55874] - Staining of human thymus shows strong cytoplasmic positivity in medullary cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Proapoptotic Caspase Adaptor Protein Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
Specificity of human Proapoptotic Caspase Adaptor Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen (NBP2-55874PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Proapoptotic Caspase Adaptor Protein Antibody

  • caspase-2 binding protein
  • FLJ32987
  • HSPC190
  • marginal zone B and B1 cell-specific protein
  • MGC29506
  • pERp1
  • plasma cell-induced ER protein 1
  • plasma cell-induced resident endoplasmic reticulum protein
  • Plasma cell-induced resident ER protein
  • Proapoptotic caspase adapter protein
  • proapoptotic caspase adaptor protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874) (0)

There are no publications for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874) (0)

There are no reviews for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874)

Discover related pathways, diseases and genes to Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874)

Discover more about diseases related to Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874).

Pathways for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874)

View related products by pathway.

PTMs for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874)

Learn more about PTMs related to Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874).

Research Areas for Proapoptotic Caspase Adaptor Protein Antibody (NBP2-55874)

Find related products by research area.

Blogs on Proapoptotic Caspase Adaptor Protein

There are no specific blogs for Proapoptotic Caspase Adaptor Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proapoptotic Caspase Adaptor Protein Antibody and receive a gift card or discount.


Gene Symbol MZB1